(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE594

CP000124.PE594       Location/Qualifiers
FT   CDS_pept        616058..617038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0603"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49793"
FT                   /db_xref="GOA:Q3JWN6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWN6"
FT                   /protein_id="ABA49793.1"
FT                   /translation="MRRRPGRIARRAAVPPDARRVSPDDPAARLRYTGFAGLSAHPTLH
FT                   FEGRSSMTDLALYAGYEALRIQRRPHGIVEIVMSGEGANRSGLAVASEAMHRELADIWR
FT                   DVDRDPDARVAVIRGEGKGFSAGGDLALVERMADAHAVRERVWREARDLVYNVINCSKP
FT                   IVSAMHGPAVGAGLVAGLLADVSIAAKHARIIDGHTRLGVAAGDHAAIVWPLLCGMAKA
FT                   KYHLLLCEPVSGEEAERIGLVSLALDDHELLPKAYEIAERLAQGSQSAIRWTKYALNNW
FT                   LRLAGPTFDASLALEFMGFSGPDVREGIRSLRERRAPDFTGGAPS"
     gtgcggcgcc gcccgggccg gattgcccgc cgggccgccg tgccgcccga cgcgcgccgg        60
     gtttcgccgg atgaccctgc cgcccgcctt cgctacactg gatttgcagg cttgtcggct       120
     caccccacac tccacttcga aggaaggtcc agcatgaccg atctcgctct ctatgccggc       180
     tatgaagcgc tgcgcatcca gcgccggccg cacggcatcg tcgaaatcgt gatgagcggc       240
     gaaggcgcga accgcagcgg cctcgcggtc gcgagcgagg cgatgcaccg cgagctcgcc       300
     gatatctggc gcgacgtcga ccgcgatccc gacgcgcgcg tcgcggtgat ccgcggcgaa       360
     ggcaagggct tctcggcggg cggcgatctc gcgctcgtcg agcgcatggc cgacgctcac       420
     gcggtgcgcg agcgcgtctg gcgcgaagcg cgcgatctcg tctacaacgt gatcaattgc       480
     agcaagccga tcgtgtcggc gatgcacggg ccggccgtcg gcgccgggct cgtcgccggg       540
     ctgctcgccg acgtgtcgat cgccgcgaag cacgcgcgga tcatcgacgg gcacacgcgt       600
     ctcggcgtcg ccgcgggcga tcacgcggcg atcgtctggc cgctgctctg cgggatggcg       660
     aaggcgaaat accacctgct cctctgcgag cccgtgagcg gcgaggaggc cgagcgcatc       720
     gggctcgtgt cgctcgcgct cgacgatcac gagctgctgc cgaaggcgta cgagatcgcc       780
     gagcgcctcg cgcaaggctc gcaaagcgcg atccgctgga ccaagtacgc gctcaacaac       840
     tggctgcggc tggccgggcc gaccttcgac gcgtcgctcg cgctcgaatt catgggtttt       900
     tccgggccgg acgtgcgcga aggcattcgc tcgctgcgcg agcgccgcgc gccggatttc       960
     acgggcggcg cgccgtcttg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page