(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE595

CP000124.PE595       Location/Qualifiers
FT   CDS_pept        617128..617937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0604"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48898"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWN5"
FT                   /protein_id="ABA48898.1"
FT                   /translation="MTDPNGSNPFSGFGGFQPAGFLDKMWDMMRLTPFGAMSALPGASQ
FT                   GLPPSLSAMSDLMAPLASVEELDKRITDLRAVEQWLKLNLGMLQSAIQALEVQRATLAT
FT                   LRAFGALAQTSMAAAEAALSPDDSAPREPASAAASASAAKREASAGEPADAQGARDADG
FT                   ETPPPGADAFDPAGWWNLLQSQFNQLARFAMTQPGMAAAGDAPAAGAAAGPKPSAAKKP
FT                   ATRRAAAPRTGGSAADRAPGASSASSASSAGGDAKPAAAKKPARRGA"
     atgaccgacc ccaacggctc caatccgttt tcaggcttcg gcggctttca gcccgccggc        60
     ttcctcgaca agatgtggga catgatgcgt ctcacgccgt tcggcgcgat gagcgcgttg       120
     cccggcgcgt cgcaagggct gccgccgtcg ttgtcggcga tgtcggacct gatggcgccg       180
     ctcgcgagcg tcgaggagct cgacaagcgg atcaccgatc tgcgcgcggt cgagcagtgg       240
     ctcaagctca acctcggcat gctgcagtcc gcgatccagg cgctcgaggt gcagcgcgcg       300
     acgcttgcga cgctgcgcgc gttcggcgcg ctcgcgcaga cgtcgatggc cgcggccgaa       360
     gccgcgctgt cgcccgacga ttccgcgccc cgcgaaccgg cttcggccgc tgcttcggct       420
     tcggcggcga agcgcgaggc gagcgccggc gagccggccg atgcgcaagg cgcgcgcgac       480
     gccgacggcg agacgccgcc gccgggcgcc gacgcgttcg acccggcggg ctggtggaat       540
     ctgctgcagt cgcaattcaa tcagcttgcg cgttttgcga tgacgcagcc gggcatggcg       600
     gcggcgggcg atgcgcctgc ggcgggcgcg gcggccgggc cgaagccgtc cgccgcgaaa       660
     aaaccggcga cgcgccgcgc cgcggccccg cgcacgggcg gctcggcggc cgaccgcgcg       720
     ccgggcgcgt caagcgcgtc gagcgcgtcg agcgcgggcg gcgatgcgaa gcccgcggcc       780
     gcgaagaagc cggccaggcg cggcgcgtga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page