(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE599

CP000124.PE599       Location/Qualifiers
FT   CDS_pept        complement(621364..621786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0608"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50074"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWN1"
FT                   /protein_id="ABA50074.1"
FT                   /translation="MLRWLISILFLANMLAFVVVRGVFGPLPAAGPREPGHALLQVRPD
FT                   ALRVTPVSQAADQPIVGGPIVPPALETAPLNAPGAAPAAASDSAPGSPAASAPASAVAP
FT                   ASMPASVAAPAAPAPSSPPAAQPARAPILPGASAAR"
     atgctgcgct ggctgatctc gattctcttt ctcgccaaca tgctcgcgtt cgtcgtggtg        60
     cgcggcgtat tcggcccgct gcccgccgcc ggcccgcgcg agccgggcca tgcgctgctg       120
     caggtgcgcc cggatgcgct gcgcgtgacg cccgtgtcgc aggcggcgga tcagccgatc       180
     gtcggcgggc cgatcgtgcc gccggcgctc gagaccgcgc cgctgaacgc gcccggcgcg       240
     gcgcccgctg cggcctccga ctcggcgccg ggctcgcctg ctgcatctgc gcccgcctct       300
     gcggttgcgc ccgcctctat gccggcgtcc gtcgccgcgc ccgctgcgcc tgccccctca       360
     tcgccgcccg ccgcgcagcc cgcccgcgcg ccgatcctcc ccggcgcatc cgccgcccgg       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page