(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE606

CP000124.PE606       Location/Qualifiers
FT   CDS_pept        630219..630857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0615"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48512"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWM4"
FT                   /protein_id="ABA48512.1"
FT                   /translation="MHAHFMSGSLSRRGRPALALAVALVMASASGCAGTPAALANIRYD
FT                   LGPAQPAASSGTGPALKVLDVSAPDALNTDRFVYRLAYSDAQRIAAYRDSKWTAPPAQL
FT                   LTQRLRGALSGRGAVLAADDGVRAPVLKVELSEFEQVFDGRSESHAAVTARATLTQEGK
FT                   VLGQRTFVSRAPASTPDAAGGAQALATASDALVSQLVAWLGVQAYAAAQ"
     atgcacgcac atttcatgtc aggttcactg tcccgccgcg gccgtccggc gctcgcgctc        60
     gccgtggcgc tcgtgatggc gagcgcgagc ggctgcgcgg gaacgcccgc cgcgctcgcg       120
     aacatccgct acgacctcgg cccggcgcag ccggccgcct cgtcgggcac cgggcccgcg       180
     ctcaaggtgc tcgacgtgag cgcgcccgat gcgctgaaca ccgatcgctt cgtctaccgg       240
     ctcgcgtact cggacgcgca gcggatcgcc gcctaccgcg acagcaaatg gacggcgccg       300
     cccgcgcaac tgctgacgca gcggctgcgc ggcgcgctgt cggggcgcgg cgcggtgctc       360
     gcggccgacg acggcgtgcg cgcgcccgtg ctgaaggtcg agctgtccga gttcgagcag       420
     gtgttcgacg gccgctcgga gagccacgcg gccgtcaccg cgcgcgcgac gctcacgcag       480
     gagggcaagg tgctcggcca gcgcacgttc gtgtcgcgcg cgccggcgag cacgccggac       540
     gcggcgggcg gcgcgcaggc gctcgccacg gcgagcgacg cgctcgtctc gcagctcgtc       600
     gcgtggctcg gcgtgcaggc gtacgcggcc gcgcaatga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page