(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE612

CP000124.PE612       Location/Qualifiers
FT   CDS_pept        635371..636318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0621"
FT                   /product="D-amino acid aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="identified by match to protein family HMM PF01063"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50292"
FT                   /db_xref="GOA:Q3JWL8"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWL8"
FT                   /protein_id="ABA50292.1"
FT                   /translation="MNQADIEPIVYLSVASHEELVPLSEARVPVLDRGFIFGDGVYEVV
FT                   PVYADGARRAPFRIAQHLARLARSLKRIGIADPHDEAGWRALVAQVVDANAAALGDGRH
FT                   AIVYIQVTRGVAKRGHAFPANAVPTVFAMASPLALPSDAQRAQGVRCVTAEDRRWLHCD
FT                   IKSVSLLGNVLMAQHAAEHDAIETIQLRDGNVTEGSSSNVWIVKNGELIAPPRSNRILE
FT                   GIRYALVEELAEECGIRFVAREINEAELRAADEILLTSATKEVLPVTRLDDLPVQGGRP
FT                   GPVFDALYAAYQRAKAREMEASERAVPPTRGETT"
     atgaatcaag ccgacatcga accgatcgtc tatctgagcg tcgcttcgca cgaggagctg        60
     gtgccgcttt ccgaagcgcg cgtgccggtg ctcgaccgcg gcttcatctt cggcgacggc       120
     gtgtacgaag tcgtgccggt ctacgcggac ggcgcgcgcc gcgcgccgtt ccggatcgcg       180
     cagcatctcg cgcgcctcgc gcgcagcctg aagaggatcg gcatcgccga tccgcacgac       240
     gaagcgggct ggcgcgcgct cgtcgcgcag gtcgtcgacg cgaacgcggc cgcgctcggc       300
     gacggccggc acgcgatcgt ctatatccag gtgacgcgcg gcgtcgcgaa gcgcggccac       360
     gcgttcccgg cgaacgctgt gccgacggtg ttcgcgatgg cgagcccgct cgcgctgccg       420
     agcgacgcgc agcgcgcgca gggcgtgcgc tgcgtgacgg ccgaggatcg ccgctggctg       480
     cattgcgaca tcaaatcggt atcgctgctc ggcaacgtgc tgatggcgca gcacgcggcg       540
     gagcacgatg cgatcgagac gatccagctg cgcgacggca acgtgacgga aggttcgtcg       600
     tcgaatgtat ggatcgtgaa gaacggcgag ctgatcgcgc cgccgcgcag caaccggatt       660
     ctcgagggca tccgctacgc gctcgtcgag gagctcgccg aggaatgcgg gattcgcttc       720
     gtcgcgcgcg agatcaacga agcggagctg cgcgcggccg acgagatcct gctcacgtcg       780
     gcgacgaagg aagtcctgcc cgtgacgcgg ctcgacgatc tgcccgtgca gggcggccgg       840
     ccgggcccgg tgttcgacgc gctgtacgcc gcgtaccagc gcgcgaaggc gcgcgagatg       900
     gaagcgtctg agcgggccgt gccgccgacg cgtggagaaa cgacatga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page