(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE614

CP000124.PE614       Location/Qualifiers
FT   CDS_pept        complement(636634..637599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0623"
FT                   /product="glycine cleavage system transcriptional
FT                   activator"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48643"
FT                   /db_xref="GOA:Q3JWL6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWL6"
FT                   /protein_id="ABA48643.1"
FT                   /translation="MNIHRLPMLNALRVFEAAARHESFSRAADELSVTHGAVSHQMRAL
FT                   EAELGVPLFVRHGKRLALTDAGGRYAQQVRAALALLADATREVRASERDKRLVVSTLPS
FT                   FAARWITPRIGPFIERHPEIDLELRASDSLVDFARDDVDVAIRFGHGVYPGLHVEPLLD
FT                   ETFFPVCAPTLNGGMLPETPADLVRYPLLRSDDELWRPWFDAAGLDTLTEPKRGVLYQD
FT                   SSNLLQAAIDGQGIALVRRSLAVPEVAAGRIVRLFDIAGPSPWHYFFVCPPSLAQTPRV
FT                   QALRSWLLDEIARFRALCAAQEAQHTAAYAAARARGKEEN"
     atgaacatcc atcgactgcc gatgctgaat gcgctgcgcg tgttcgaggc cgccgcgcgg        60
     cacgaaagct tctcgcgcgc ggcagacgag ttgtccgtca cgcacggcgc ggtcagccac       120
     cagatgcgcg cgctggaagc cgagctcggc gtgccgctgt tcgtgcgcca cggcaagcgg       180
     ctcgcgctga cggacgcggg cggccgctac gcgcagcagg tgcgcgccgc gctcgcgctg       240
     ctcgccgacg cgacccgcga ggttcgcgcg agcgagcgcg acaagcggct cgtcgtgtcg       300
     acgctgccgt cgttcgccgc gcgctggatc acgccgagga tcggcccgtt catcgaacgg       360
     catccggaaa tcgacctgga gctgcgggca agcgattcgc tcgtcgattt cgcgcgcgac       420
     gacgtcgatg tcgcgatccg cttcggccac ggcgtctatc cggggctgca cgtcgagccg       480
     ctgctcgacg agacgttctt tcccgtctgc gcgccgacgc tcaacggcgg catgctgccc       540
     gagacgcccg ccgatctcgt ccgctatccg ctgctgcgct cggacgacga gctgtggcgg       600
     ccgtggttcg acgcggcggg gctcgacacg ctgaccgagc cgaagcgcgg cgtgctgtat       660
     caggattcgt cgaatctgct gcaggcggcg atcgacggcc agggcatcgc gctcgtgcgg       720
     cgctcgctcg cggtgccgga ggtggcggcc ggccggatcg tgcggctctt cgacatcgcg       780
     gggccgagcc cgtggcacta cttcttcgtg tgcccgccgt cgctcgcgca aacgccgcgc       840
     gtgcaggcgc tcaggagctg gctgctggac gagatcgcgc gcttcagggc gctgtgcgcg       900
     gcgcaggagg cgcagcacac ggcggcctat gcggccgcgc gtgcgcgcgg caaggaggaa       960
     aactag                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page