(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE77

CP000124.PE77        Location/Qualifiers
FT   CDS_pept        85581..86783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0083"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47574"
FT                   /db_xref="GOA:Q3JY53"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY53"
FT                   /protein_id="ABA47574.1"
FT                   /translation="MNRNARSGDVRRVPPRLPAGRRSPLTGAKLAPPLGEFLPLRNGET
FT                   LMRIAQIAPLYEAVPPKLYGGTERVVSYLTEALVEMGHDVTLFASGDSVTSARLEAAWP
FT                   RALRLDPSIRDAMAPHMRLLEQVARAAHTFDILHFHLDYLPFPLLSRLDAPFVTTLHGR
FT                   LDLPELQPVFDAFPNAPVVSISDSQRTPLPQAGWAGTVYHGLPDTLLTPQAGRKPEYLA
FT                   FLGRICPEKRVDTAIRIAAQSGLPLKIAAKVDKVDEDYFKAEIEPLLDSAHVEFIGEIN
FT                   EAQKPAFLSGAKALLFPIDWPEPFGLVMIEAMACGTPVVAFNRGSVPEVIDDGLTGFIV
FT                   EDVQGAVGALHRIDELSRDAIRAQFEQRFSSHAMARRYIDIYETLRGATKQPQWQRVAA
FT                   G"
     atgaatcgga acgcccggtc cggcgacgtt cgccgcgtac cgccccgtct gcccgccggc        60
     aggcgctcac cgcttaccgg agcgaagctc gcaccgcccc tcggcgagtt cctccctctt       120
     cgcaacggag aaacgctcat gcgcatcgcc caaatcgccc cgctctacga agccgtcccg       180
     cccaaactct acgggggcac cgagcgggtc gtgtcctacc tgaccgaggc gctcgtcgaa       240
     atggggcacg acgtcacgct gttcgcaagc ggggattccg tcacgtcggc gcggctggaa       300
     gccgcatggc cgcgcgcgct gcgcctcgat ccgtcgatcc gcgacgcgat ggcgccccat       360
     atgcgcttgc tcgagcaggt cgcacgggcc gcgcacacgt tcgacatcct gcacttccac       420
     ctcgactacc tgccgttccc actgctgtcg cgcctcgacg cgccgttcgt cacgacgttg       480
     cacggccgcc tcgatctgcc ggagctgcag cccgtgttcg acgcgttccc gaacgcgccc       540
     gtcgtgtcga tctcggattc gcagcgcacg ccgctgccgc aagccggatg ggccggcacc       600
     gtctaccacg ggctgcccga cacgctgctc acgccgcaag ccggccgcaa gcctgaatat       660
     ctcgcgtttc tcggccgcat ctgcccggaa aaacgcgtcg acaccgcaat ccggatcgcc       720
     gcgcaaagcg gcctgccgct gaagattgct gcgaaagtcg acaaggtcga cgaggattat       780
     ttcaaggccg agatcgaacc gctgctcgat tccgcgcacg tcgagttcat cggcgagatc       840
     aacgaagcac agaagcccgc cttcctgtcg ggcgcgaagg cgctgctgtt tccgatcgat       900
     tggcccgagc cgttcggcct cgtgatgatc gaggcgatgg catgcggcac gcccgtcgtc       960
     gcgttcaacc gcggctccgt gccggaagtc atcgatgacg gcctgacggg cttcatcgtc      1020
     gaggacgtac agggcgcggt gggcgcgctg caccggatcg acgaattgtc acgcgatgca      1080
     attcgtgcgc aattcgagca acgtttcagc tcgcatgcaa tggcgcggcg ctatatcgac      1140
     atctatgaaa cgctgcgcgg cgcaaccaag caaccgcaat ggcagcgcgt agcggcgggt      1200
     taa                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page