(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE78

CP000124.PE78        Location/Qualifiers
FT   CDS_pept        complement(86887..87183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bprA"
FT                   /locus_tag="BURPS1710b_0084"
FT                   /product="H-NS histone family protein"
FT                   /note="identified by match to protein family HMM PF00816"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50703"
FT                   /db_xref="GOA:Q3JY52"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY52"
FT                   /protein_id="ABA50703.1"
FT                   /translation="MSQYAKIKAQIVELQAQAEEVRRQEIAAVVAELQGKIAEYGLTAQ
FT                   DLGFAERARRGRPPKKGPLPAKYRDPKSGNTWSGRGKPPHWIVGKNRERFLIG"
     atgtctcaat acgcgaaaat caaggcgcag atcgtggagc tgcaagccca ggccgaagaa        60
     gtacgtcgtc aggaaatcgc ggccgtggtc gccgagttgc aaggcaagat cgccgagtac       120
     gggctcacgg cgcaggactt ggggttcgcc gagcgggcgc ggcgcggccg gccgccgaag       180
     aagggcccgc tgcccgccaa gtaccgcgat ccgaaatccg gcaacacgtg gagcggccgc       240
     ggcaagcccc cgcattggat cgtcggcaaa aaccgcgagc gctttttgat cggctga          297
//

If you have problems or comments...

PBIL Back to PBIL home page