(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE81

CP000124.PE81        Location/Qualifiers
FT   CDS_pept        complement(89321..90211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0087"
FT                   /product="BadF/BadG/BcrA/BcrD ATPase family superfamily"
FT                   /note="identified by match to protein family HMM PF01869"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47871"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY49"
FT                   /protein_id="ABA47871.1"
FT                   /translation="MGNDIFLIGIDGGGTGTRAVLADARGRELAQGSAGPSGLALGIEA
FT                   AWRSIEAASAEACARAGVAFDWRHCVLGCGLAGVNHRAWLNAFRASAPLAALAIESDAY
FT                   TTVVGAHGGAPGVIVALGTGSIAAALDASGACRIAGGYGFPSGDEASGAWLGLRALSYA
FT                   QQALDGRAPLDALARALVAHTGAPDRDALIVWSCEANQTAYAQLAPIVLAHRDHPAAAH
FT                   WIEQAGIEIGRMIDALDPAAALPVALCGGLAQALASAVPEPHGARLVAPQADSAHGALR
FT                   LAEREAARLGLTAPR"
     atgggcaacg acatttttct gatcggcatc gacggcggcg gcaccggcac gcgcgcggtg        60
     cttgccgatg cgcgcgggcg cgagctcgcg cagggcagcg cggggccgtc cgggctcgcg       120
     ctcggcatcg aggcggcgtg gcgctcgatc gaggccgcca gcgcggaggc ttgcgcgcgc       180
     gccggcgtcg cgttcgactg gcggcattgc gtgctcggct gcgggctcgc cggcgtgaac       240
     catcgcgcgt ggctgaatgc gttccgggcg agcgcgccgc tggccgcgct ggcgatcgag       300
     agcgatgcgt atacgactgt cgtcggcgcg cacggcggtg cgccgggcgt gatcgtcgcg       360
     ctcggcacgg gcagcatcgc ggccgcgctc gacgcgtcgg gcgcgtgccg gatcgcgggc       420
     ggatacggtt ttccgtccgg cgacgaggcg agcggcgcgt ggctcggcct acgcgcgctg       480
     tcctacgcgc agcaagcgct cgacggccgg gcgccgctcg acgcgctggc ccgcgcgctc       540
     gtcgcgcaca cgggcgcgcc cgaccgcgac gcgctcatcg tctggtcgtg cgaagcgaat       600
     caaaccgcgt atgcgcagct tgcgccgatc gtgctcgccc atcgcgacca tccggcggcc       660
     gcgcactgga tcgagcaggc gggcatcgag attggccgaa tgatcgacgc gctcgatccg       720
     gcggcggcgc tgcccgtcgc gttatgcggc gggctggcgc aggcgctcgc gagcgcggtg       780
     cccgagccgc atggcgcgcg gctcgtcgcg ccgcaagccg attccgcgca cggcgcgctg       840
     cggctcgccg agcgggaggc ggcgcggctc gggctcacgg cgccgcgctg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page