(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE83

CP000124.PE83        Location/Qualifiers
FT   CDS_pept        complement(91357..91728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0089"
FT                   /product="30S ribosomal protein S21.-related protein"
FT                   /note="identified by match to protein family HMM PF01165;
FT                   match to protein family HMM TIGR00030"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48583"
FT                   /db_xref="GOA:Q3JY47"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JY47"
FT                   /protein_id="ABA48583.1"
FT                   /translation="MLVAERFAVHSASLFRPPRPLPARFACSWKRPEGRCVALGRYVFD
FT                   RIKQIRNDMTTILLKENEPFEVAIRRFRRAIEKNGLIAELRERQAYEKPTAVRKRKKAA
FT                   AVKRLHKRLRSQMLPKKLH"
     gtgttggttg ccgagcgttt cgcggtgcat tccgcctctc ttttccggcc tccgaggccg        60
     ctacccgctc gtttcgcctg ttcgtggaaa cgcccggaag gccggtgcgt ggcgcttggc       120
     cgctacgttt ttgaccgtat caagcaaatt aggaacgaca tgacgacgat tcttttgaaa       180
     gaaaacgagc cgttcgaagt ggcgattcgc cgcttccgcc gcgcgatcga gaagaacggc       240
     ctgatcgccg agctgcgcga gcgccaggca tacgagaagc cgaccgccgt gcgcaagcgc       300
     aagaaggcgg ctgcggtgaa gcgcctgcac aagcgcctgc gcagccagat gctgccgaag       360
     aagctccact aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page