(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE88

CP000124.PE88        Location/Qualifiers
FT   CDS_pept        95379..97844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0094"
FT                   /product="TPR domain protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51108"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY42"
FT                   /protein_id="ABA51108.1"
FT                   /translation="MSGRRRRPGADDSPNWRLFPVQFAALARSARPDNFHHCTLRPANP
FT                   MSESTTSDTLTPEQQFEEDIALVLKNAIELHHQGDFENARALYEAIVDAKPDHADAQYD
FT                   LGVLKVQIGRAADALPHFEIALGGAPNNGQYWVSYVNALIDAGQIAAAWTALGLCQQRG
FT                   VRGPAVDGLILRLAHSEEGKPAYIGTAAAAPEAAAPADAAANAAEPARADARKPSEQDV
FT                   RRFATLYNKRRMAEAIKFARALAQRYPGSGVAWKSLGFALHRDGQYGPACEALTKGAAM
FT                   LPDDAECNTLYADTLRVLNRLADAEAQVRRVLDGTPDYAEAHRVLNMTLSARGRYQEAI
FT                   EAGRRSVELAPNSVNAHGSLAVTLSDYGQTDEAEIHFRRAHELNPKDPMAYSNLLFCQS
FT                   HKIDVSIRELFDAHRAFGELYEAPLRGATPKHANSRDPERRLRIGFVSGDLFLHAVSSY
FT                   LLPLVDELAKDPSVSLHFYYTFAREDSVTERIRSYAQGWHMVMPLSDEQFAERVRHDRI
FT                   DILVDLSGHSGRNRLPMFARKPAPIQVSWIGYPGTTGLEAIDYYLADPYAVPFGPMQAQ
FT                   FTEKIVHLSSGATFSPDGNAPPVNMLPALHNGHVSFGSFNRLNKLRGDVIAVWARIMRA
FT                   VPGSRIVLGSIPKDGGGAAMIEWFEQEGIARERLSFQPRSVTAVYLQQHHHVDVCLDTF
FT                   PYTGSTTVLNALWMGVPTLTMRGETLPSRAGLTWMSHVGLESFIADDIDDFVAKGIALA
FT                   SDIPALARIRGELRERCMRSPAFQPQRVAQDVSDAFRIMWRRWCDGQPPAPFAVPPRDA
FT                   TTTVAGDRS"
     ttgtccggcc gccgccggcg gccgggcgcc gacgattcgc caaattggcg gctctttcct        60
     gttcagttcg ccgcattggc ccgctcggcc cggccggata attttcacca ttgcacactc       120
     cgtccggcta accccatgtc cgaatcgacg acgtccgaca ccctgacgcc cgagcaacag       180
     ttcgaggagg acatcgcgct cgtcctcaag aacgcgatcg agctgcatca ccaaggtgat       240
     ttcgagaacg cgcgcgcgct ctacgaggcg atcgtcgacg cgaagccgga ccacgccgac       300
     gcccaatacg acctcggcgt gttaaaggtc cagatcggcc gggccgccga cgcgctgccg       360
     cacttcgaga tcgcgctcgg cggcgcgccg aacaacggcc agtactgggt cagctatgtg       420
     aacgcgctga tcgatgccgg ccagatcgcg gcggcatgga ccgcgctcgg gctctgccag       480
     cagcgcggcg tgcgcggccc ggccgtcgac gggctgatcc tgcggctcgc gcattcggag       540
     gaaggcaaac cggcctatat cggcacggcg gccgcggcac cggaagccgc ggcgccggcc       600
     gatgccgcgg cgaacgccgc ggagcccgcg cgcgccgacg cgcgcaagcc gtccgagcag       660
     gatgtccggc gcttcgcgac gctctacaac aagcggcgca tggcggaggc gatcaagttc       720
     gcgcgcgcgc tcgcccagcg ctatccgggc agcggcgtcg cctggaaatc gctcggcttc       780
     gcgctccatc gcgacggcca gtacgggccg gcctgcgaag cgctgaccaa gggcgcggcg       840
     atgctgcccg acgatgccga atgcaacacg ctctatgcgg acacgctgcg cgtgctgaac       900
     cggctcgccg acgccgaagc tcaggtgcgg cgtgtgctcg acggcacgcc cgattatgct       960
     gaagcgcatc gcgtgctgaa catgacgctg agcgcgcgcg gccgctacca ggaagcgatc      1020
     gaggccggcc ggcgctcggt cgagctcgcg ccgaactcgg tgaacgcgca cggctcgctc      1080
     gcggtgaccc tcagcgacta cgggcagacc gacgaagccg aaatccattt ccgccgcgcg      1140
     cacgaactca atccgaagga tccgatggcg tacagcaacc tgctgttctg ccagtcgcac      1200
     aaaatcgacg tgtcgatccg cgagctgttc gacgcgcatc gcgcgttcgg cgagctgtac      1260
     gaagcgccgc tgcgcggcgc gacgccgaaa catgcgaact cccgcgatcc ggaacgccgc      1320
     ctgcgcatcg gattcgtgtc gggcgacctg ttcctgcacg cggtgtcctc ctatctgctg      1380
     ccgctcgtcg acgagctcgc gaaggacccg agcgtgtcgc tgcacttcta ttacacgttc      1440
     gctcgcgaag attcggtgac cgagcggatt cgctcgtacg cgcaaggctg gcacatggtg      1500
     atgccgctca gcgacgagca attcgccgaa cgcgtgcgcc acgacaggat cgacatcctc      1560
     gtcgacctgt ccggccacag cgggcgcaac cggctgccga tgttcgcgcg caagcccgcg      1620
     ccgatccagg tgagctggat cggctacccc ggcacgaccg ggctcgaggc gatcgactat      1680
     tacctcgccg atccgtacgc ggtgccgttc ggcccgatgc aggcgcagtt caccgagaag      1740
     atcgtccacc tgtcgtcggg cgcgacgttc tcgccggacg gcaacgcgcc gcccgtcaac      1800
     atgctgcccg cgctgcacaa cggccacgtg agcttcggca gcttcaaccg gctcaacaag      1860
     ctgcggggcg acgtgatcgc cgtgtgggcg cgcatcatgc gcgcggtgcc cggttcgcgc      1920
     atcgtgctcg gctcgattcc gaaggacggc ggcggggccg cgatgatcga gtggttcgag      1980
     caagaaggga tcgcgcgcga gcggctgtcg ttccagccac gctcggtcac ggccgtctat      2040
     ctgcagcagc accatcacgt cgacgtgtgc ctcgacacgt tcccgtacac cggctcgacc      2100
     accgtgctca acgcgctgtg gatgggcgtg ccgacgctga cgatgcgcgg cgagaccttg      2160
     ccgagccgcg ccggcctcac atggatgtcg cacgtcgggc tcgaatcgtt catcgcagac      2220
     gacatcgacg acttcgtcgc caagggcatc gcgctcgcgt ccgacatccc ggcgctcgcg      2280
     cgcatccgcg gcgagttgcg cgagcgctgc atgcgctcgc cggcgttcca gccgcagcgc      2340
     gtcgcgcagg atgtgtccga cgcctttcgc atcatgtggc gccgctggtg cgacggccag      2400
     ccgcccgccc cgttcgcggt gccgccgcgc gacgcaacga caaccgtcgc aggagaccgc      2460
     tcatga                                                                 2466
//

If you have problems or comments...

PBIL Back to PBIL home page