(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE96

CP000124.PE96        Location/Qualifiers
FT   CDS_pept        102715..103779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0102"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="identified by match to protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51166"
FT                   /db_xref="GOA:Q3JY34"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY34"
FT                   /protein_id="ABA51166.1"
FT                   /translation="MNFDTDLLHRHWHLGCHRRELPNDGDFVRFDTAIGEIVIFNDAGE
FT                   LVAFDNRCPHRGARMYVDDSGNQPASCPYHGWTYREGRLLIPGRERFDGCALERAKLRT
FT                   FAVDWCGDFLFFAVHPQTDLYTQLGRFAEAVENISFNIDRRLDLNRYDFECYWPLAIEN
FT                   ALEPYHIGAVHPQTLATLGLEDGENVFDGVNCAWYAPVGASRQRNQLARLKRFFNLDYQ
FT                   YEGYASIYLFPFTMISSTYGYSYSLQHFLPAGVGGDRTRFTSRLYAAPAASEQAAQALG
FT                   AFFESTRDVNRRVFEEDHAICKRMPRNAWSMAPLACAADTEAKIDHFRRACRTFAASRA
FT                   ALPVVDATREAAAG"
     atgaatttcg atacggacct cctccatcgc cactggcatc tcggctgtca ccgccgggag        60
     cttccgaacg acggcgattt cgtgcgcttc gacaccgcaa tcggcgaaat cgtgatcttc       120
     aacgatgcgg gcgagctcgt cgcgttcgac aaccgctgcc cgcaccgcgg cgcccgcatg       180
     tatgtggacg acagcggcaa ccagccggcg agctgcccgt accacggctg gacgtatcgc       240
     gagggccggc tgctgatacc gggccgcgag cgcttcgacg gctgcgcgct cgagcgcgcg       300
     aagctgcgta cgttcgccgt cgactggtgc ggcgacttcc tgttctttgc cgtccacccg       360
     cagaccgatc tctacacgca gctcggcaga ttcgccgagg ccgtcgagaa catctcgttc       420
     aacatcgatc gacgcctcga cttgaaccgc tacgatttcg aatgctactg gccgctcgcg       480
     atcgagaacg cgctcgagcc gtaccacatc ggcgccgttc atccgcagac actcgccacg       540
     ctcgggctcg aagacggcga gaacgtgttc gacggcgtca attgcgcatg gtacgccccc       600
     gtcggcgcga gccggcagcg caatcagctc gcccggctca agcgcttctt caatctcgat       660
     taccaatacg aagggtacgc gagcatctat ctgtttccgt tcacgatgat ctcgtcgacg       720
     tacggctact cgtattcgct gcagcatttt ctgcccgcgg gcgtcggcgg cgatcgcacg       780
     cgcttcacta gccggcttta tgcggcgccc gcggcgagcg aacaggcggc gcaggcgctc       840
     ggcgccttct tcgaatcgac gcgagacgtc aatcggcggg tgttcgaaga ggaccacgcg       900
     atctgcaagc gaatgccgag gaacgcgtgg tcgatggcgc cgctcgcgtg cgcggccgac       960
     accgaagcga aaatcgatca tttccgccgc gcgtgccgca cgttcgccgc gtcgcgcgcc      1020
     gcgcttcccg tcgtcgacgc gacacgcgag gcggcggccg ggtaa                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page