(data stored in SCRATCH9089 zone)

EMBL: CP000124.PHEC

CP000124.PHEC        Location/Qualifiers
FT   CDS_pept        178261..179046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheC"
FT                   /locus_tag="BURPS1710b_0172"
FT                   /product="cyclohexadienyl dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50393"
FT                   /db_xref="GOA:Q3JXW5"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="InterPro:IPR037298"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXW5"
FT                   /protein_id="ABA50393.1"
FT                   /translation="MKMNQTLLALACCAGLAHAQTAPQPGAPASRLDDVLARGTLRVCT
FT                   TGDYKPYTYRREDGAFEGIDIDMAASLAKSLGVKTAFVKTTWPTLTDDFVAKCDIAVGG
FT                   ISTTLERQKRVFFTQPYVSDGKTPIVRCADAERYQTIAQIDQPQTRVIVNPGGTNERFA
FT                   KQHFTRAKLTVFPDNVTIFKQILAGNADVMVTDASETLLQQKLNPGLCSVHPDKPFQFG
FT                   EKAYMVPRGDVVFQQYVDQWLHLARETGELRAISDKWLK"
     atgaaaatga accagacgtt gctcgcgctc gcctgctgcg cggggctcgc ccatgcacaa        60
     accgcgccgc agccgggcgc gcccgcgtcg cggctcgacg acgtgctcgc gcgcggcacg       120
     ctgcgcgtat gcacgacggg cgactacaag ccgtacacgt accggcgcga ggacggcgcg       180
     ttcgaaggca tcgacatcga catggcggcc tcgctcgcga aatcgctcgg cgtgaagacg       240
     gcgttcgtga agaccacatg gccgaccctc accgatgatt tcgtcgcgaa gtgcgacatc       300
     gcggtgggcg gcatctcgac gacgctcgaa cggcagaagc gcgtgttctt cacgcagccg       360
     tacgtgagcg acggcaagac gccgatcgtg cgctgcgcgg atgccgagcg ctatcagacg       420
     atcgcgcaga tcgaccagcc gcaaacgcgc gtgatcgtga atccgggcgg cacgaacgag       480
     cgttttgcga agcagcattt cacccgcgcg aagctcaccg tgtttccgga caacgtgacg       540
     atcttcaagc agattctcgc gggaaatgcc gacgtgatgg tcacggacgc gtccgagacg       600
     ctgctgcagc aaaagctgaa tcccggcctg tgctcggtgc acccggacaa gccgttccag       660
     ttcggcgaga aggcgtacat ggtgccgcgc ggggacgtcg tgttccagca gtacgtcgac       720
     cagtggctgc atctcgcacg cgagacgggc gagctgcggg cgatctcgga caagtggctc       780
     aagtag                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page