(data stored in SCRATCH9089 zone)

EMBL: CP000124.PHNA

CP000124.PHNA        Location/Qualifiers
FT   CDS_pept        489459..489863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnA"
FT                   /locus_tag="BURPS1710b_0482"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /note="identified by match to protein family HMM PF03831;
FT                   match to protein family HMM TIGR00686"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49345"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX07"
FT                   /protein_id="ABA49345.1"
FT                   /translation="MRAGEYTFTYSINCKQGCNTMSTLPACPQCAMENTYPDGEHYICA
FT                   DCGHEWPIAGDANAADDDAAAVVKDANGNVLADGDAVVLIKDLKVKGSSITLKMGTKVK
FT                   SIRLVGGDHEVDCKMDAGNFMLKACYLKKV"
     gtgcgggcgg gcgagtatac tttcacgtat tcgatcaact gcaaacaagg ctgcaacacc        60
     atgtcgacgc ttcccgcctg cccgcaatgc gcaatggaaa acacgtaccc ggacggcgaa       120
     cattatattt gcgcggactg cggacacgaa tggccgatcg cgggcgacgc gaacgccgcc       180
     gatgacgacg cggccgctgt cgtgaaggac gcgaacggca acgtgctcgc cgacggcgac       240
     gcggtcgtgc tgatcaagga cctgaaggtg aagggctcgt cgatcacgct gaagatgggc       300
     acgaaggtga agagcatccg tctcgtcggc ggcgatcacg aagtcgactg caagatggac       360
     gccggcaatt tcatgctgaa ggcgtgctat ctgaagaagg tttga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page