(data stored in SCRATCH9089 zone)

EMBL: CP000124.PHOA2

CP000124.PHOA2       Location/Qualifiers
FT   CDS_pept        580626..582029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoA2"
FT                   /locus_tag="BURPS1710b_0568"
FT                   /product="alkaline phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00245"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49523"
FT                   /db_xref="GOA:Q3JWS1"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWS1"
FT                   /protein_id="ABA49523.1"
FT                   /translation="MSTIKRIAAAAFAAAALSGGFGHAAHAAGQAKNVIFFLGDGMGPA
FT                   TVTASRLYKVGEAGQLTMEKLPRTARIKTFSNDAQTTDSAPSMAAYMTGVKMNNEVLSM
FT                   SPDTRAIAPGSDANGNKTVNRCGVGNGTPAATLLELAKARGKAVGAITTTELTHATPAA
FT                   TYSHICHRDAQYDIAVQAVPGGAGYNAALGDGVDVLMGGGRNHWTPYDPLANRRGRADG
FT                   RNLLAELQAKGYAVVATKDQLAQAGAGKLIGLFSTTSHLEYELDRVAGKGEGATQPSLA
FT                   EMTAKAIDVLRKNPNGYFLMVEGGRIDHALHGTNAKRALEDTVAFDEAIRTALAKVDLS
FT                   DTLIVVTADHDHTMTINGYSKRGNPVLDISRNYRDGQPNKDADGNPYTTLVFGNGANRP
FT                   NVRVPVDSSTATNDAYLQEVGVRMGSAGSETHGGGDVMLFADGAGAKAFKGTLDNTKVF
FT                   GLVKAAFGF"
     atgtcgacta tcaagcgcat cgcggcggcg gcgttcgccg cggcggccct ctcgggcggt        60
     ttcggccacg cggcgcacgc cgcgggccag gcgaagaacg tgatcttctt cctcggcgac       120
     gggatggggc cggccaccgt gacggcgagc cgcctctaca aggtcggcga agccggccaa       180
     ctgacgatgg aaaagctgcc gcgcaccgcg cgcatcaaga ccttctcgaa cgacgcgcag       240
     acgacggaca gcgcgccgtc gatggccgcg tacatgaccg gcgtgaagat gaacaacgag       300
     gtgctgtcga tgtcgccgga cacgcgcgcg atcgcccccg gcagcgacgc gaacggcaac       360
     aagacggtga accgctgcgg cgtgggcaac ggcacgccgg cggcgacgct gctcgagctc       420
     gcgaaggcgc gcggcaaggc ggtcggcgcg atcacgacga ccgagctcac gcacgcgacg       480
     cccgcggcga cttactcgca catctgccat cgcgacgcgc agtacgacat tgccgtgcag       540
     gccgtgccgg gcggcgcggg ctacaacgcg gcgctcggcg acggcgtcga cgtgctgatg       600
     ggcggcggcc gcaatcactg gacgccgtac gatccgctcg ccaacaggcg cggccgcgcg       660
     gacgggcgca acctgctcgc cgagctgcag gcgaagggct acgcggtggt cgcgacgaag       720
     gatcagctcg cgcaggcggg cgcgggcaag ctgatcggcc ttttcagcac gacgagccat       780
     ctcgaatacg agctcgaccg cgtcgcgggc aagggcgagg gcgcgacgca gccgagcctc       840
     gcggagatga ccgcgaaggc gatcgacgtg ttgcggaaga atccgaacgg ctatttcctg       900
     atggtcgaag gcgggcgcat cgaccacgcg ctgcacggca cgaacgcgaa gcgcgcgctc       960
     gaagacacgg tggcgttcga cgaggcgatc cgcaccgcgc tcgcgaaggt cgatctatcg      1020
     gatacgctga tcgtcgtgac ggccgatcac gatcacacga tgacgatcaa cggctattcg      1080
     aagcgcggca atccggtgct cgacatcagc cgcaactatc gcgacggcca gccgaacaag      1140
     gacgcggacg gcaacccgta cacgacgctc gtgttcggca atggcgcgaa ccggccgaac      1200
     gtgcgcgtgc cggtggattc gtcgacggcg acgaacgacg cgtatctgca ggaagtcggc      1260
     gtgcgcatgg gcagcgcggg ttccgagacg catggcggcg gcgacgtgat gctgttcgcc      1320
     gacggcgccg gcgcgaaggc gttcaagggc acgctcgaca acacgaaggt gttcggcctc      1380
     gtgaaggccg cgttcgggtt ctga                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page