(data stored in SCRATCH9089 zone)

EMBL: CP000124.REBB

CP000124.REBB        Location/Qualifiers
FT   CDS_pept        complement(469199..469420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rebB"
FT                   /locus_tag="BURPS1710b_0458"
FT                   /product="RebB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50918"
FT                   /db_xref="InterPro:IPR021070"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX31"
FT                   /protein_id="ABA50918.1"
FT                   /translation="MAFPTSVNDQITDSVTQANTKVLGDAPAIAMGNLYQATAQALANT
FT                   AHNATNAQQQSYVTALAERRDGGAATTI"
     atggcattcc cgaccagcgt caacgaccag atcaccgatt ccgtcacaca ggccaatacc        60
     aaggtattgg gcgacgcgcc ggcgatcgcg atgggcaatc tctaccaggc caccgcgcaa       120
     gcgcttgcca ataccgccca caacgccacc aacgcgcagc agcagagcta cgtcaccgca       180
     ttagcggaac gcagggatgg cggggcggcc acgacgatat ga                          222
//

If you have problems or comments...

PBIL Back to PBIL home page