(data stored in SCRATCH9089 zone)

EMBL: CP000124.RFAE

CP000124.RFAE        Location/Qualifiers
FT   CDS_pept        620827..621312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaE"
FT                   /locus_tag="BURPS1710b_0607"
FT                   /product="rfaE bifunctional protein, domain II"
FT                   /EC_number="2.7.7.-"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125; match to protein
FT                   family HMM TIGR02199"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50187"
FT                   /db_xref="GOA:Q3JWN2"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWN2"
FT                   /protein_id="ABA50187.1"
FT                   /translation="MPASFERKLITRDALAAMRASLPAPVVFTNGVFDILHRGHVSYLA
FT                   DAKALGACLIVGVNSDASVRMLGKGDDRPINVQEDRMALLAALECVDWVVGFDEKTPVS
FT                   LIEAVHPDILVKGGDYDMDALPESALVRGWGGRALAIPFEHDRSTTALLKKVRAQSR"
     atgcccgctt cgttcgaacg caagctgatc acccgcgacg cgctcgccgc catgcgcgcg        60
     tcgctgcccg cgcccgtcgt cttcacgaac ggcgtattcg acatcctgca tcgcggccac       120
     gtcagctatc tcgccgacgc gaaggcgctc ggcgcgtgcc tcatcgtcgg cgtgaacagc       180
     gacgcatcgg tgcgcatgct cggcaagggc gacgatcggc cgatcaacgt gcaggaagac       240
     cggatggcgc tgctcgccgc gctcgaatgc gtcgactggg tcgtcggctt cgacgagaag       300
     acgccggtgt cgctgatcga ggcggtgcat cccgacatcc tcgtgaaggg cggcgactac       360
     gacatggatg cattgcccga atcggcgctc gtgcgcggct ggggcgggcg cgcgctcgcg       420
     attccgttcg agcacgatcg ctcgacgacc gcgttgttga agaaggtgcg cgcgcagtcg       480
     cgctga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page