(data stored in SCRATCH9089 zone)

EMBL: CP000124.RNPA

CP000124.RNPA        Location/Qualifiers
FT   CDS_pept        312836..313303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="BURPS1710b_0302"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /note="identified by match to protein family HMM PF00825;
FT                   match to protein family HMM TIGR00188"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49183"
FT                   /db_xref="GOA:Q3JXI5"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXI5"
FT                   /protein_id="ABA49183.1"
FT                   /translation="MSAVRSDAGEAAAVRGSIPLQASAAFPKAARLLKTDEFSSVFRLR
FT                   PWRRTAHFVIYGKPTGRDARLGLVIGKKYAARAVTRNLVKRLAREAFRTRRAEFAGWDI
FT                   LLRLHARFDKKAMPSAASAPLAALCAGEIRELLDRAAREVARRNGAKPASE"
     gtgtccgccg tccgcagcga tgcgggcgag gcagccgctg tccggggttc gattccgttg        60
     caagcgtccg ccgccttccc caaagctgcg cgacttctga aaacggatga attctcatcc       120
     gtttttcgtt tgcgtccctg gcggcgcacc gcgcacttcg tgatctacgg caagccgacg       180
     gggcgcgatg cgcgtcttgg gctcgtcatc ggcaagaagt acgccgcgcg tgcggtgacg       240
     cgcaatctgg tcaagcggct cgcccgcgag gcgtttcgta cgcgtcgcgc cgagttcgcc       300
     ggctgggaca ttctgctgcg cctgcatgcg cgcttcgaca agaaggcgat gccgagcgcc       360
     gcatccgcgc cgctcgcggc gctgtgcgca ggcgagatcc gcgagctgct cgaccgggca       420
     gcccgggagg tcgcccggcg caacggggcg aagcccgcgt ccgagtga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page