(data stored in SCRATCH9089 zone)

EMBL: CP000124.RPOD

CP000124.RPOD        Location/Qualifiers
FT   CDS_pept        complement(339625..341073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="BURPS1710b_0325"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="identified by match to protein family HMM PF00140;
FT                   match to protein family HMM PF04539; match to protein
FT                   family HMM PF04542; match to protein family HMM PF04545"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51026"
FT                   /db_xref="GOA:Q3JXG2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXG2"
FT                   /protein_id="ABA51026.1"
FT                   /translation="MKVSARELRYEQGIDRLLELAGARDDTEYADVADEFASAPSSAFA
FT                   HDLGEPDSLDHQASDESAGAGSFGDKPTRPAHGDTDVDTDWRDDDAPPSGSNDAAPVDT
FT                   TASTDPLALFVRRMHAVPLLTHAQEIALAAEIEAGREQVLQALAEALDRLDLASLPADP
FT                   ALGRARAALQRARARGDEGARACARARTAAYAALAAHGWPSAEVDAVRRAMRRLPTSPE
FT                   KSDAGAQRAFADGEARISAATARMAEANLRLVLSIARKYASRGLDLADLLQEGNLGLLR
FT                   AIEKFEHRRGFKFSTYATWWIRQAISRAVADRARTIRVPVHVGDEARRVRKAADRIERR
FT                   SGVSASLAELSEATGLPAERLRAVLTLPREPRSLNAPLGDDDQAEFGDIVEDTSTPSLF
FT                   DALAHGQMCDVVTSLLKTMSAQEADILRRRFGIGGDEPWSYEQIAARAGVSREQVRRIE
FT                   KRALQTLRVTAEACNAHDFLDVQP"
     atgaaagtct cagcgcgcga attgcgctac gaacagggca tcgaccggtt gctcgaactt        60
     gccggcgctc gcgacgacac ggaatacgcc gatgtcgccg acgagttcgc gagcgcgccg       120
     tccagcgcgt tcgcgcatga tctcggcgag cccgattccc tggatcacca agcatccgac       180
     gaaagcgcag gcgccggctc gttcggcgac aagccgacgc ggcccgcgca cggcgacacc       240
     gatgtcgaca ccgactggcg tgacgacgat gcgccgccct ccggatcgaa cgacgccgcg       300
     ccggtcgaca ccacggcctc gaccgatccg ctcgcgctct tcgtacgccg gatgcacgcg       360
     gtgccgctgc tgacgcacgc ccaggaaatc gcgctcgccg ccgaaatcga ggcgggacgc       420
     gagcaggtgc tgcaagcgct cgccgaagcg ctcgaccggc tcgacctcgc gtcgttgccg       480
     gccgatccgg cgcttggccg tgcgcgcgcc gcgctgcagc gcgcacgcgc gcgcggtgac       540
     gaaggcgcgc gcgcgtgtgc ccgcgcgcgc acggcggcat acgcggcgct cgccgctcac       600
     ggctggccgt cggcggaagt cgacgcggtg cggcgggcaa tgcgccggct gccgacatcg       660
     ccggaaaaga gcgacgcggg cgcgcaacgt gcgttcgcgg acggcgaagc gcgcatctcg       720
     gccgcgaccg cgcgaatggc ggaagcgaac ctgcggctcg tgctgtcgat cgcgcgcaag       780
     tacgcgtcgc gcggcctgga tctcgccgat ctgctgcagg aaggcaacct cggcctgctg       840
     cgcgcgatcg agaaattcga gcatcggcgc ggcttcaagt tttcgacgta tgcgacgtgg       900
     tggattcgtc aggcgatttc acgcgcggtc gccgaccgcg cacgcacgat tcgcgtgccg       960
     gttcatgtcg gcgacgaagc gcgccgcgtg cgcaaggccg ccgatcggat cgaacggcgc      1020
     agcggtgtaa gcgcatcgct cgccgagctg tcggaggcga ccgggctgcc ggccgagcgg      1080
     ctgcgcgcgg tgctgacgct gcctcgcgag ccgcgctcgc tgaacgcgcc gctaggcgat      1140
     gacgaccagg ccgaattcgg cgacatcgtc gaggatacgt cgacgccgag cctgttcgat      1200
     gcgctcgccc acgggcagat gtgcgacgtc gtcacgtcgc tgctgaaaac gatgtccgcg      1260
     caggaagccg acatcctgcg ccggcgcttc ggcatcggcg gcgacgagcc gtggagctac      1320
     gagcagatcg ccgcgcgagc aggcgtgtcg cgcgagcagg tacgccgcat cgagaagcgc      1380
     gcgctgcaga cgctgcgcgt gacggccgaa gcgtgcaacg cgcacgactt cctcgacgtg      1440
     cagccgtaa                                                              1449
//

If you have problems or comments...

PBIL Back to PBIL home page