(data stored in SCRATCH9089 zone)

EMBL: CP000124.SILA

CP000124.SILA        Location/Qualifiers
FT   CDS_pept        518712..521924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="silA"
FT                   /locus_tag="BURPS1710b_0514"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="identified by match to protein family HMM PF00873;
FT                   match to protein family HMM TIGR00914"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51050"
FT                   /db_xref="GOA:Q3JWX5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWX5"
FT                   /protein_id="ABA51050.1"
FT                   /translation="MIAHVIRWSIRNRLLVLLATALVAAWGVVSLNRTPLDALPDLSDT
FT                   QVIVKASYPGKAPRVVEDQVTYPLTTTLLGVPGAKTIRAYSSFGDAFVYVLFDDRTDQY
FT                   WARSRVLEYLNQVQGRLPQGASVALGPDATGVGWVYEYALVDRSGRRDLGELRALNDWF
FT                   LKFELKAVPDVAEVASVGGMVRQYQVVLDPDRLRAFGITQAAVADALGKANSESGGSVV
FT                   EMAESEYMVRASGYLRSLDDFRNVVLRTSESGTPVLLGDVARVQIGPEMRRGIAELNGE
FT                   GEVAGGVIVMRSGKNALSTIEAVKAKLAELRRSLPAGVELVTTYDRSQLIGRAVDNLKD
FT                   KLIEEFVVVGLVCALFLFHLRSAFVAILSLPLGVLAAFIVMRHQGVNANLMSLGGIAIA
FT                   IGAMIDAAVVMIENAHKHLESHEHAHPGAPLSSAARWELIAASAAEVGPALFFSLLIVT
FT                   LSFVPVFALEGQEGKLFAPLAFTKTYTIAAAAGLSVTLVPVLMGYLIRGRIPREASNPL
FT                   NRLLVRLYRPLLEATLARPWRAIAIAAAALVLTAIPMSRLGGEFMPPLDEGDLLYMPTA
FT                   LPGISAQKAAELLQQTDRLIKTVPEVATVFGKSGRADTATDPAPLEMFETTIRFRPRGE
FT                   WRPGMTPGRLVDELDRVVKVPGLSNVWVPPIRNRLDMLSTGIKTPVGVKIAGPELAQID
FT                   RIAAQVEAAVKRVPGVTSALAERLNGGRYVDVDIDRRAAARYGLSVGDVQAVVASAIGG
FT                   ENVGEVIAGRERFPINIRYPREVRDSLEKLRALPIVTERGAQILLRDVAAVTIADGPPM
FT                   IRSENARLSGYVYVDIRGVDLKTAVGAMQRAVAQQVALPPGYSIAWSGQFEYLERAAAT
FT                   LRTVIPVTLAVIFVLLFLTFDSAADALLLMTTVPFALVGGLWFVWALGHAVSVATAVGF
FT                   IALAGVAAEFGVVMLLYLKRAYERRIAAGEPPNEATLADAIREGAVLRVRPKAMTVAVV
FT                   LAGLVPIMIGHGSGSEVMQRIAAPMVGGMVTAPLLSMFVIPAAWLLLQRRRMRGAARAA
FT                   SQAPVAGAAGADFSSIHTGESR"
     atgatcgcgc acgtcattcg atggtcgatt cgcaatcgcc tgctcgtgct gctcgcgacc        60
     gcgctcgtcg ccgcatgggg cgtggtgtcg ctgaaccgca cgccgctcga cgcgctgccg       120
     gatctgtccg acacgcaggt gatcgtcaag gcgtcgtatc cgggcaaggc gccgcgggtc       180
     gtcgaagatc aggtgaccta tccgctgacg accacgctgc tcggcgtgcc cggcgcgaag       240
     acgatccgcg cgtattcgtc gttcggcgac gcgttcgtct acgtgctgtt cgacgacagg       300
     accgatcagt actgggcacg ctcgcgtgtg ctcgagtatc tgaaccaggt tcaaggccgc       360
     ctgccgcaag gcgcgagcgt cgcgctcggg ccggacgcga cgggcgtcgg ctgggtctac       420
     gaatacgcgc tcgtcgacag gagcgggcgg cgcgatctgg gcgagctgcg cgcgttgaac       480
     gactggttcc tgaagttcga gctgaaggcc gtgcccgatg tcgcggaggt cgcgagcgtc       540
     ggcgggatgg tgcgccagta tcaggtcgtg ctcgatcccg acaggctgcg cgcgttcggc       600
     atcacgcagg cggccgtcgc cgacgcgctc ggcaaggcga acagcgaatc gggcggctcc       660
     gtcgtcgaga tggcggaatc cgagtacatg gtgcgcgcga gcggctacct gcgctcgctc       720
     gacgacttcc gcaacgtcgt gctgcgcacg agcgaatccg gcacgccggt gctgctcggc       780
     gacgtcgcgc gcgtgcagat cggcccggag atgcgacgcg gcatcgccga gctcaacggc       840
     gagggcgagg tcgcgggcgg cgtgatcgtg atgcgttccg gcaagaacgc gctgtcgacg       900
     atcgaggccg tgaaggcgaa gctcgccgag ctcaggcgtt cgctgcccgc gggcgtcgag       960
     ctcgtgacga cgtacgatcg ctcgcaactg atcgggcgcg cggtcgacaa tctgaaggac      1020
     aagctcatcg aggagttcgt ggtcgtcggg ctcgtgtgcg cattgttcct gtttcatctg      1080
     cgcagcgcgt tcgtcgcgat cctctcgctg ccgctcggcg ttctcgccgc gttcatcgtg      1140
     atgcgccatc agggcgtcaa cgcgaacctg atgtcgctcg gcggcatcgc gatcgcgatc      1200
     ggcgcgatga tcgacgcggc cgtcgtgatg atcgaaaacg cgcacaagca cctcgaatcg      1260
     cacgagcacg cgcatccggg cgcgccgctg tcgagtgcgg cgcgctggga gctgatcgcg      1320
     gcgtcggcgg ccgaagtcgg gcccgcgctc tttttctcgc tgctgatcgt cacgctgtcg      1380
     ttcgttccgg tgttcgcgct cgaaggtcag gaaggcaaac tgttcgcgcc gctcgcgttc      1440
     acgaagacgt atacgatcgc ggcggcggcg ggcctgtcgg tcacgctcgt gccggtgctg      1500
     atgggttacc tgattcgcgg gcgcattccg cgcgaggcat cgaatccgct gaaccggctg      1560
     ctcgtgcggc tctaccggcc gcttctcgag gcaacgctcg cgcggccgtg gcgcgcgatc      1620
     gccatcgcgg ccgcggcgct cgtgctcacc gcgattccga tgtcgcggct cggcggcgag      1680
     ttcatgccgc cgctcgacga aggcgatctg ctgtacatgc ccaccgcgct gccgggcatt      1740
     tccgcgcaga aggcggccga gctgctgcag cagaccgacc gcctgatcaa gacggtgccc      1800
     gaggtggcga ccgtgttcgg caagtcgggc cgcgcggaca ccgcgaccga tccggcgccg      1860
     ctcgagatgt tcgagacgac gatccgcttc aggccgcgcg gcgagtggcg gccggggatg      1920
     acgcccggca ggctcgtcga cgagctcgat cgcgtcgtga aggtgccggg cctgtcgaac      1980
     gtgtgggtgc cgccgatccg caaccggctc gacatgctgt cgaccggcat caagacgccc      2040
     gtcggcgtga agatcgccgg cccggagctc gcgcagatcg accggatcgc ggcgcaggtc      2100
     gaggcggcgg tgaagcgcgt gccgggcgtc acgtcggcgc tcgccgagcg gctgaacggc      2160
     gggcgctacg tggacgtcga catcgaccgg cgcgcggcgg cgcgctacgg gctgtcggtc      2220
     ggcgacgtgc aggcggtcgt cgcgtcggcg atcggcggcg agaacgtcgg cgaggtgatc      2280
     gcggggcgcg agcgctttcc gatcaacatc cgctatccgc gcgaagtacg cgactcgctc      2340
     gagaaactgc gggcattgcc gatcgtcacc gagcgcggcg cgcagatcct gctgcgcgac      2400
     gtcgccgccg tgacgatcgc cgacgggccg ccgatgatcc gcagcgagaa tgcgcggctg      2460
     tcgggctacg tgtacgtcga tattcgcggt gtcgacctga agacggccgt cggcgcgatg      2520
     cagcgcgcgg tcgcgcaaca ggtcgcgctg ccgcccggct attcgatcgc gtggtccggg      2580
     cagttcgaat atctggagcg tgcggccgcg acgctgcgca cggtgattcc ggtgacgctt      2640
     gccgtgatct tcgtgctgct gttcctgaca ttcgattcgg cggccgacgc gctgctgctg      2700
     atgacgaccg tgccgttcgc gctcgtcggc ggtctctggt tcgtgtgggc gctgggccat      2760
     gcggtgtccg tcgcgaccgc ggtcggcttc atcgcgctcg cgggtgtggc ggccgagttc      2820
     ggcgtcgtga tgctgctgta tctgaagcgc gcatacgagc ggcgcatcgc cgccggcgag      2880
     ccgccgaacg aagcgacgct cgccgacgcg attcgcgaag gcgcggtgct gcgcgtgcgg      2940
     ccgaaggcga tgacggtcgc cgtcgtgctc gcgggcctcg tgccgatcat gatcgggcac      3000
     ggttcgggtt ccgaagtgat gcagcgcatc gccgcgccga tggtgggcgg catggtcacg      3060
     gcgccgctgc tgtcgatgtt cgtcattccc gccgcgtggc tcctgttgca gcgccgccgc      3120
     atgcgcggcg cggcccgtgc ggcgtcgcag gcccccgttg ccggcgctgc cggcgcggat      3180
     ttttcgtcca tccataccgg agaatctcga tga                                   3213
//

If you have problems or comments...

PBIL Back to PBIL home page