(data stored in SCRATCH9089 zone)

EMBL: CP000124.SILC

CP000124.SILC        Location/Qualifiers
FT   CDS_pept        515832..517133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="silC"
FT                   /locus_tag="BURPS1710b_0512"
FT                   /product="outer membrane efflux protein"
FT                   /note="identified by match to protein family HMM PF02321"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48943"
FT                   /db_xref="GOA:Q3JWX7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWX7"
FT                   /protein_id="ABA48943.1"
FT                   /translation="MYSMLRAPHGRRARLHARTLVAALTFANAAAAFAQSAPLTLDAAL
FT                   QSAADRSAAMQAAQASVQASAELAVKAGQLPDPMLKAGIDNLPVDGPQRFTIGQESMTM
FT                   RRIGIAQEWVSGDKRRLRTALANEVVGRERAGYLAQLADVRRQTAIAWLDAAYAKKALA
FT                   LQRELADEMNRELAATQAAYRGAKATAADALQARALLAQARDRQANARQAFDTALIGLS
FT                   RWVAAPTLDVAGEPPAPVSFVPSLPPDELRRVQPTLIAADEDVEVADADVALAASERRP
FT                   NWTWEIAYQQRGAPYANMVSIGVTIPLPLDRRDRQDRDVAQKRALATKARLMYEDARRQ
FT                   VDADIRTQSATLESGRARLAELGRALLPAADERVRLADAAYRAGAGSLADAFAARRARL
FT                   DARLQVLDLERDVARAWAQLDYQIVPSAMLAAAQ"
     atgtattcga tgcttcgcgc gccgcacggc cggcgtgcgc gcctgcacgc gcgcacgctc        60
     gtcgcggcgc tcactttcgc gaacgccgcc gccgcgttcg cccaatcggc gccgctcacg       120
     ctcgacgccg cgctgcaatc ggccgccgac cgatcggcgg cgatgcaggc ggcgcaggcg       180
     tccgtccagg cgagcgccga gctcgccgtc aaggccgggc aattgcccga tccgatgctg       240
     aaggccggca tcgacaatct gcccgtcgac ggcccgcaac gcttcacgat cggccaggaa       300
     tcgatgacga tgcgccgcat cggcatcgcg caggagtggg tgtcgggcga caagcgccgg       360
     ctgcgcaccg cgctcgcgaa cgaagtcgtc ggccgcgaac gcgccggcta tctcgcgcaa       420
     ctcgcggacg ttcgccggca gacggccatc gcgtggcttg acgccgcata cgcgaagaag       480
     gcgctcgcgc tgcagcgcga actcgccgac gagatgaacc gcgagctcgc cgcgacgcag       540
     gccgcgtatc gcggcgcgaa ggcgacggcc gccgacgccc tgcaggcgcg cgcgctgctc       600
     gcgcaggcgc gcgaccggca agcgaacgcc cgccaggcgt tcgacaccgc gctgatcggc       660
     ctgtctcgct gggttgccgc gccgacactc gacgtggcgg gcgagccgcc cgcgccggtg       720
     tcgttcgtgc cgtcgctgcc gcccgacgag ctgcgccgtg tgcagccgac gctgatcgcg       780
     gccgacgagg acgtggaggt ggccgacgcc gacgtcgcgc tcgccgcgag cgagcggcgt       840
     ccgaactgga cgtgggagat cgcgtatcag cagcgcggcg cgccgtacgc gaacatggtg       900
     tcgatcggcg tcacgattcc gctgccgctc gatcggcgcg atcggcagga ccgcgacgtc       960
     gcgcaaaagc gcgcgctcgc cacgaaggcg cggctgatgt acgaggatgc gcggcgtcag      1020
     gtcgacgcgg atatccgcac gcaatcggcg acgctcgaga gcggccgcgc gcggctcgcg      1080
     gagctcgggc gagcgctgct gcccgcggcc gacgagcgcg tgcgccttgc cgacgccgcg      1140
     taccgcgcgg gcgcgggctc gctcgccgac gcgttcgccg cgcgtcgcgc gcggctcgat      1200
     gcgcggctcc aggtgctcga tctcgaacgc gacgtcgcgc gagcgtgggc gcagctcgac      1260
     tatcagatcg tcccgtcggc gatgctcgcc gccgcacagt ga                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page