(data stored in SCRATCH9089 zone)

EMBL: CP000124.SILP

CP000124.SILP        Location/Qualifiers
FT   CDS_pept        complement(510128..512551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="silP"
FT                   /locus_tag="BURPS1710b_0506"
FT                   /product="copper-translocating P-type ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM PF04945; match to protein family HMM TIGR01494;
FT                   match to protein family HMM TIGR01511; match to protein
FT                   family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50952"
FT                   /db_xref="GOA:Q3JWY3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JWY3"
FT                   /protein_id="ABA50952.1"
FT                   /translation="MHDAHVHHDRSGDTNERRDPHRPHETKTPGETAVDPVCGMKVPID
FT                   TPRRYDYQGRTYRFCSDKCATAFRASPQRFVGTPKQRAGASAAKPGTVYTCPMHPQIRA
FT                   NAPGACPICGMALEPLTPDAAEDGNPELRSMTRRFELGLVLAVPLVLMTMGAMVLPFDI
FT                   GAGIDALLARWPRPFGMPASWSQWVQAALATPVVLWGGWPFLVRGWKSFVTRRLNMFSL
FT                   IGLGVCVAYLFSVFALLFPDTLPQAFRSGHEIPLYFEASAVIVTLVLLGQVLELRARSR
FT                   TSSAIRDLLQLAPHTAVRVNPDGSEQTVPLDAVVVGDTLRVKPGSKVPVDGIVVAGHSS
FT                   VDESMITGEPVPAEKTEGSPVTGATVNQTGTFVMRAQKIGTDTLLARIVQMVAEAGRSR
FT                   APIQKLADQVSGGFVLAVIVLAALAFAAWAAFGPAPALANALVVAISVLIIACPCALGL
FT                   ATPVSIIVGVGRGAREGVLIKDAEALELMEKVDTVVVDKTGTLTEGRPRVQTIVALGGQ
FT                   SERALLGDAASLEGASEHPLAQAIVEHAARMGAERKPVASFDSVPGKGVKGTLDARTVA
FT                   LGNAHLMADLAIDCTAADADSNRLREAGQTVMYVAIDGQLAGYIGVADPIKETTPDAVQ
FT                   LLKASGTRIVMLTGDNPVTANAVARTLSLDGVKAGVLPEDKYRHVQALQQQGHVVAMAG
FT                   DGVNDAPALAQANVGIAMGTGTDVAMNSARIVLVKGDLRGIARARALSVATMKNIRQNL
FT                   FFAFVYNAVGIPVAAGVLYPWFGITLSPIFASAAMAASSVSVIGNALRLRGAKT"
     atgcacgacg cacatgtcca tcacgatcgc agcggcgaca cgaacgaacg gcgcgatccg        60
     caccgcccgc acgaaacgaa gacgccgggc gaaacggcgg tcgatccggt ctgcggaatg       120
     aaggtgccga tcgacacacc ccgtcgatac gactatcaag gccgcacgta tcgcttctgc       180
     agcgacaagt gcgcgacggc gttccgcgcg tcgccgcagc ggttcgtcgg cacgccgaag       240
     cagcgggccg gcgcatccgc ggcgaagccg ggcacggtct acacgtgccc gatgcacccg       300
     cagatacgcg cgaacgcgcc gggtgcctgc ccgatctgtg gaatggcgct cgagccgctc       360
     acgccggacg ccgccgaaga cggcaatccc gagctccgat cgatgacgcg gcgcttcgag       420
     ctcgggctcg tgctggccgt gccgctcgtg ctgatgacga tgggtgcgat ggtgctgccg       480
     ttcgacatcg gcgccggcat cgacgcgctg ctcgcgcgct ggccgcggcc gttcggaatg       540
     ccggcatcgt ggtcgcaatg ggtgcaggcc gcgctcgcga cgcccgtcgt gctgtggggc       600
     ggctggccgt ttctcgtgcg cggctggaag tcgttcgtca cgcggcggtt gaacatgttc       660
     agcctgatcg ggcttggcgt ctgcgtggcg tatctgttca gcgtgtttgc gctgctgttc       720
     cccgacacgc tgccgcaggc gtttcgcagc ggccacgaaa tcccgctcta cttcgaggcg       780
     tccgcggtga tcgtgacgct cgtgctgctc ggccaggtgc tcgagttgcg cgcgcgctcg       840
     cgcacgtcga gcgcgatccg cgacctgctg cagctcgcgc cgcacacggc ggtgcgcgtg       900
     aatcccgacg gctcggagca aaccgtgccg ctcgacgcgg tcgtcgtcgg cgacacgctg       960
     cgcgtgaagc ccggctcgaa ggtgccggtc gacggcatcg tcgtcgccgg gcattcgagc      1020
     gtcgacgaat cgatgatcac cggcgagccg gtgcccgccg agaagaccga gggcagcccg      1080
     gtgacgggcg cgaccgtcaa ccagacgggc accttcgtga tgcgcgcgca gaagatcggc      1140
     accgacacgc tgctcgcgcg gatcgtgcag atggtcgccg aggccgggcg ctcgcgcgcg      1200
     ccgatccaga aactcgccga tcaggtgtcc ggcgggttcg tgctcgccgt catcgtgctc      1260
     gccgcgctcg cgttcgccgc ctgggcggcg ttcggtccgg ctcccgcgct cgcgaacgcg      1320
     ctcgtggtgg cgatcagcgt gctcatcatc gcctgcccgt gcgcgctcgg cctcgcgaca      1380
     cccgtgtcga tcatcgtcgg tgtcggccgc ggcgcgcgcg agggcgtgct catcaaggat      1440
     gccgaagcat tggagctgat ggagaaagtc gataccgtcg tcgtcgacaa gaccggcacg      1500
     ctgaccgagg ggcgcccgcg cgtgcagacg atcgtcgcgc tcggcgggca gtccgagcgc      1560
     gcgctgctgg gcgatgcggc gagcctcgag ggcgcgagcg agcatccgct cgcgcaggcg      1620
     atcgtcgagc acgccgcgcg gatgggcgcc gagcgcaagc ccgtcgcgtc gttcgattcg      1680
     gtgcccggaa aaggcgtgaa aggcaccctc gacgcccgca cggtcgcgct cggcaacgcg      1740
     cacctgatgg cggatctcgc gatcgactgc acggcggccg acgccgattc gaaccgcctg      1800
     cgcgaagccg gccagacggt gatgtacgtc gcgatcgacg ggcagcttgc cggttatatc      1860
     ggcgttgccg acccgatcaa ggagacgacg ccggacgcgg tgcaactgct caaggcgtcg      1920
     ggcacgcgca tcgtgatgct gacgggcgac aaccccgtca ccgcgaacgc ggtcgcccgg      1980
     acgctgtcgc tcgacggcgt gaaggcgggc gtgctgcccg aggacaagta caggcacgtg      2040
     caagcgctgc agcaacaagg gcacgtcgtc gcgatggcgg gcgacggcgt caacgatgcg      2100
     ccggcgctcg cgcaagcgaa cgtcggcatc gcgatgggca cgggcaccga cgtcgcgatg      2160
     aacagcgcgc ggatcgtgct cgtgaagggc gacctgcgcg gcatcgcgcg ggcgcgcgcg      2220
     ctcagcgtcg cgacgatgaa gaacatccgg cagaacctgt tcttcgcgtt cgtctacaac      2280
     gcggtcggca ttccggtcgc ggcgggcgtg ctgtatccgt ggttcggcat cacgctgagc      2340
     ccgatcttcg cgagcgccgc gatggcggcg agctcggttt ccgtcatcgg caacgcgctg      2400
     cggctgcgcg gcgcgaagac gtga                                             2424
//

If you have problems or comments...

PBIL Back to PBIL home page