(data stored in SCRATCH9089 zone)

EMBL: CP000124.SLT

CP000124.SLT         Location/Qualifiers
FT   CDS_pept        463565..465520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slt"
FT                   /locus_tag="BURPS1710b_0453"
FT                   /product="soluble lytic murein transglycosylase"
FT                   /EC_number="3.2.1.-"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49877"
FT                   /db_xref="GOA:Q3JX36"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX36"
FT                   /protein_id="ABA49877.1"
FT                   /translation="MSTSLFRVYRAVAAPLVAIALAAVAAACAAQTADEASSNDDRVFV
FT                   QLREAARRNDPVRAAQLAALIPNYPAPSYLEYFQIKPQLFDSAGHARLDAPDAPVLSFL
FT                   SRYDGQAIADRMRNDYLLVLGARHDWRAFDEQYKRFVLDDDTQVKCYALESRASRGENV
FT                   ADMARELLVEPKYYGDACVDLITALATNKQFSSDDVWAQVRLAYEQNYTTLGGKIADAL
FT                   GPRPVGFDQVTSAPPLFLARGVGSDATSRQLALVAITRMARNDPEAAAGQLASLASTLS
FT                   AAEQAIGWGEIGYQATVKRLPQAASWYRKSMDAPLSNPAYEWRVRAALLAGDWPMVRRS
FT                   IEQMPERLRDDTAWIYWRGRALKESGDTLKANQEFERIAGQFNFYGQLAGEELGQKTTI
FT                   PPRTKVTDAEIDAMSKVPGFALAQRFYALNLRLEGNREWNWPLRGMTDRQLLAAAEYGK
FT                   RVDLLDRTVNTADRTTAEHDFSLRYPSPYRDIVERYARTNGLDVEWAYGLIRQESRFIT
FT                   NARSTVGAGGLMQLMPATAQLVAKKLGLGTVSRAQMHDIDTNVQLGTWYLSDIYQKFDD
FT                   SAVLATAGYNAGPGRPAQWRQVLTRPVEGAIFAETIPFNETREYVKNVLSNETYYAALF
FT                   EKKPQSLKARLGFIAP"
     atgtcaacca gcctttttcg agtatatcgc gcggtcgcgg cgcccctcgt cgcgatcgcg        60
     ctggccgccg tggcggccgc ctgcgccgcg cagaccgccg acgaagcgtc gtcgaacgac       120
     gatcgggtgt tcgtccagct gcgcgaggcc gcgcgcagga acgatccggt gcgcgccgcg       180
     cagctcgccg cgctgatccc gaattatccg gcgccgtcat atctcgagta cttccagatc       240
     aagccgcagt tgttcgattc ggcgggccat gcgcgccttg acgcgccgga cgcgccggtg       300
     ctgtcgttcc tgtcgcgcta cgacggccag gcgatcgccg accgcatgcg caacgattac       360
     ctgctcgtgc tcggcgcgcg ccatgactgg cgcgccttcg acgagcagta caagcgcttc       420
     gtgctcgacg acgacacgca ggtcaagtgc tatgcgctcg aatcgcgcgc atcgcgtggc       480
     gagaacgtcg cggacatggc gcgcgagctg ctcgtcgagc cgaagtatta cggcgacgcg       540
     tgcgtcgacc tcatcacggc gctcgcgacg aacaagcagt tctcgagcga cgacgtgtgg       600
     gcgcaggtgc gcctcgcgta cgagcagaac tacacgacgc tcggcggcaa gattgccgac       660
     gcgctcggcc cgcgcccggt cggcttcgat caggtgacga gcgcgccgcc gctgttcctc       720
     gcgcgcggcg tgggctccga cgcgacgtcg cggcaactcg cgctcgtcgc gatcacgcgc       780
     atggcgcgca acgatccgga agcggcggcg gggcagctcg cgtcgctcgc gtcgacgctg       840
     tcggcggccg agcaggcgat cggctggggc gagatcggct atcaggcgac ggtcaagcgg       900
     ctgccgcagg ccgcgtcgtg gtaccggaaa tcgatggacg cgccgctgtc gaatccggcg       960
     tacgaatggc gtgtgcgcgc ggcgctgctc gccggcgact ggccgatggt gcgccgctcg      1020
     atcgagcaga tgcccgagcg gctgcgcgac gacacggcat ggatctactg gcgcggccgc      1080
     gcgctgaagg agagcggcga cacgctcaag gcgaaccagg agttcgagcg catcgccggg      1140
     cagttcaact tctacgggca gctcgcgggc gaggagctcg gccagaagac gacgatcccg      1200
     ccgcgcacga aggtgacgga cgccgagatc gacgcgatga gcaaggtgcc gggcttcgcg      1260
     ctcgcgcagc gcttctatgc gctgaacctg cggctcgaag gcaaccgcga atggaactgg      1320
     ccgctgcgcg ggatgaccga tcggcaactg cttgcggcgg ccgagtacgg caagcgcgtc      1380
     gacctgctcg accgcacggt caacaccgcc gatcgcacga cggccgagca cgatttctcg      1440
     ctgcgctatc cgtcgccgta tcgcgacatc gtcgagcgct acgcgcggac caacgggctc      1500
     gacgtcgaat gggcgtacgg gctgatccgc caggaatcgc gcttcatcac gaacgcgcgc      1560
     tcgacggtgg gcgcgggcgg cctgatgcaa ctgatgccgg cgaccgcgca actcgtcgcg      1620
     aagaagctcg gcctcggcac ggtctcgcgc gcgcagatgc acgacatcga tacgaacgtg      1680
     cagctcggca cctggtatct gtccgacatc taccagaagt tcgacgattc ggccgtgctc      1740
     gcgacggccg gctacaacgc cggcccgggc cggccggccc aatggcggca ggtgctcacg      1800
     cgccccgtcg aaggcgcgat cttcgcggag acgatcccgt tcaacgagac gcgcgaatac      1860
     gtgaagaacg tgctgtccaa cgagacgtac tacgcggcgc tcttcgagaa gaagccgcaa      1920
     tcgctgaagg ctcgcctcgg cttcatcgcg ccgtaa                                1956
//

If you have problems or comments...

PBIL Back to PBIL home page