(data stored in SCRATCH9089 zone)

EMBL: CP000124.SMF

CP000124.SMF         Location/Qualifiers
FT   CDS_pept        complement(361726..363030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smf"
FT                   /locus_tag="BURPS1710b_0345"
FT                   /product="SMF family protein"
FT                   /note="identified by match to protein family HMM PF02481;
FT                   match to protein family HMM TIGR00732"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47594"
FT                   /db_xref="GOA:Q3JXE3"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXE3"
FT                   /protein_id="ABA47594.1"
FT                   /translation="MIGQSPWARARGIRSISDDENFITALRSPQAALFEEFIMSPRALT
FT                   RAELSGWLRLAGASGVPAAACAALLGAFASLEALFAASHAELAALVGDAAAQSVLAPPA
FT                   ADFEQRVDAALAWLDEPGNALVTRHDPAYPGPLAELYDPPPLLYIKGRVALLHARAVAI
FT                   VGSRGATPQGLADATRFARELSDAGLAIVSGLARGIDGAAHRGGLDGASGTVAVIGTGA
FT                   DLVYPACHHALAHEIAERGALVSEWPLGTPARSAHFPQRNRLIAALSGGVLIVEAALRS
FT                   GSLITARLANEMGRDVFAIPGSIHAPLSQGCHALIRDGAKLVETAADVLDEFGLDPARP
FT                   VNSKRGAPAAASADADLDDDTRRLLDAIGYGPVPLELLAQRTSLPSGTLHRLLLQLELA
FT                   GRVAALPGGRYTRIDGAQAEPAQARGTSAVLHSGA"
     atgatcggcc aatcgccgtg ggcccgtgcg cgcggcattc gttctatttc ggatgatgaa        60
     aattttatca cggcactacg cagcccgcag gccgcgcttt tcgaggaatt catcatgtcg       120
     ccgcgagcgc tgacgcgcgc cgaactctcc ggctggctgc ggcttgccgg cgcatccggc       180
     gtgccggcgg ccgcgtgtgc cgcgctcctc ggcgcgttcg catcgctcga agcgctcttc       240
     gcggcgtcgc atgcggagct ggcggcgctc gtcggcgacg cggcggccca atccgtgctc       300
     gccccgccgg cggccgattt cgagcagcgc gtcgacgcgg cgctcgcctg gctcgacgag       360
     cccggcaacg cgctcgtgac ccggcacgat cccgcctatc ccgggccgct ggcggagctc       420
     tacgatccgc cgccgctgct atatataaaa ggccgcgtcg cgctgctcca tgcgcgggcc       480
     gtcgcgatcg tcggcagccg cggggcgacg ccgcaggggc tcgccgacgc gacgcgcttc       540
     gcgcgcgagc tgtcggacgc gggcctggcg atcgtgtcgg gcctcgcccg cggcatcgac       600
     ggcgccgcgc atcgcggcgg gctcgacggc gcaagcggca ccgtcgccgt gatcggcacg       660
     ggcgcggacc tcgtctatcc ggcgtgccac cacgcgctcg cccacgagat cgccgagcgc       720
     ggcgcgctcg tctccgagtg gccgctcggc acgcccgcac ggtccgccca ttttccgcag       780
     cgcaatcggc tgatcgccgc gctgtccggc ggcgtgctga tcgtcgaggc ggcgctgcgc       840
     tccggctcgc tgatcaccgc gcggctcgcg aacgaaatgg ggcgcgacgt gttcgcgatt       900
     cccggctcga tccacgcgcc cctgtcgcaa ggctgccacg cgctgatccg cgacggcgcg       960
     aaactcgtcg agaccgcggc cgacgtgctc gacgaattcg gcctcgatcc cgcccggccg      1020
     gtgaattcga agcgcggcgc gcccgccgcc gcatcggccg atgccgacct ggacgacgac      1080
     acgcgccggc tgctcgacgc aatcggctac ggccccgtgc cgctcgagct gctcgcacaa      1140
     cgcacgtcgc ttccgagcgg cacgctgcat cggttgttgc tgcagctgga gctggccggc      1200
     cgcgtcgccg cgctgccggg cggccgctat acccgcatcg acggcgcaca ggccgagccc      1260
     gctcaagcgc gcggcacgag cgccgtgcta cattccggcg catag                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page