(data stored in SCRATCH9089 zone)

EMBL: CP000124.SOJ

CP000124.SOJ         Location/Qualifiers
FT   CDS_pept        complement(192195..192965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soj"
FT                   /locus_tag="BURPS1710b_0188"
FT                   /product="chromosome partitioning protein ParA"
FT                   /note="identified by match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49822"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXU9"
FT                   /protein_id="ABA49822.1"
FT                   /translation="MAKIFCVANQKGGVGKTTTTVNLAASLAAQGQRVLLIDLDPQGNA
FT                   TMGSGIDKAECESTVYEVLVDGVTVADARVRPEAVKYDVLPANRELAGAEIELVSVENR
FT                   ERQLKAALAKVADDYDFVLIDCPPALSLLTLNGLCAAHGVVIPMQCEYFALEGLSDLVN
FT                   TIKQVHANLNRDLKVIGLLRVMFDPRITLQQQVSDQLKAHFGDKVFDAVIPRNVRLAEA
FT                   PSYGLPGVVFDRGSRGAQAYIQFGAEMIERVRAL"
     atggcaaaga tcttctgcgt ggcgaaccag aagggcggcg taggcaagac gacgacgacg        60
     gtcaatctcg ccgcgagcct cgcggcgcag gggcagcgcg tgctgctgat cgatctggac       120
     ccgcagggca atgccacgat gggcagcggc atcgacaagg cggaatgcga gtcgacggtc       180
     tatgaggtgc tggtcgatgg tgtgacggtt gcggacgcgc gcgtgcgtcc cgaagcggtc       240
     aagtacgacg ttttgccggc gaaccgcgaa cttgccggtg cggaaatcga gctggtcagc       300
     gtggagaatc gcgagcgcca gttgaaggct gcgctcgcga aagtcgctga cgattacgat       360
     ttcgtgctga tcgattgtcc tcccgcgctg tcgttgctga cgctgaatgg tttgtgtgcg       420
     gcgcatggcg tcgtgatccc gatgcaatgc gaatatttcg cgctcgaggg cttgtccgac       480
     ctcgtcaaca cgatcaagca ggtgcatgcg aacctgaatc gggatttgaa agtcatcggt       540
     ctgctgcgag tgatgttcga tccgcggatc acgctgcagc aacaggtttc cgatcagttg       600
     aaggcgcact tcggcgacaa ggtgttcgac gctgtgattc cgcgcaacgt gcgccttgcc       660
     gaggcgccca gctatgggct ccccggcgtc gtattcgatc gcggttcgcg cggcgcgcag       720
     gcgtacattc agttcggcgc ggaaatgatc gagcgggtgc gcgcgctttg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page