(data stored in SCRATCH9089 zone)

EMBL: CP000124.SUN

CP000124.SUN         Location/Qualifiers
FT   CDS_pept        366724..368283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="BURPS1710b_0350"
FT                   /product="ribosomal RNA small subunit methyltransferase B"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01189;
FT                   match to protein family HMM TIGR00563"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51179"
FT                   /db_xref="GOA:Q3JXD8"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXD8"
FT                   /protein_id="ABA51179.1"
FT                   /translation="MLRTPPLRAPARVSPIPGALQYRADRPRAGPRRLPTTRPARPCAA
FT                   GTADPMTQTRPSRSRASGAPSRAPRLSALHLVPDSLGFALDGAAQAVDAVDRGAALPAA
FT                   LAAVHAALPSNAQAASRGAIQDIGYRAMRRRGTADWLIAQLVAKAPPAHVHALLVCAFA
FT                   LLVDDEHAAYAPFTVVDQAVTAIGARRECSFAKGLVNAVLRRFLRERAAWLERLQADRR
FT                   ALWNYEPWWIDAVERAWPDAWQRILAAGDAPGPLTLRVNARRMTADAYLDTLRAERIDA
FT                   EKIGLHAIRLASARPVERIPGFADGIVSVQDAGAQLSAEWLGARDGMRVLDACAAPGGK
FT                   TGHILELAHAEVVALESDPARAPRIGENLARLSLTADVRVGDAADPAQWHDGRPFDRVL
FT                   ADVPCSASGIVRRHPDIRWLRRAADIPALVAEQRRILSALWPLVKPGGELLYVTCSIFP
FT                   EEGELQARWFGDACQDAVRLDAPGQLLPQGATGGAPAVGGSGESGRHVDHDGFFYARFQ
FT                   KR"
     atgctccgca cgcccccatt gcgcgcaccc gcccgcgtga gcccgatccc cggcgcgcta        60
     caatatcgcg ctgaccggcc gcgggccggc cctcggcgcc ttcctaccac ccgcccggcg       120
     cgaccgtgtg ccgcgggcac tgctgatccg atgacccaga ctcgcccttc ccgttcccgc       180
     gcatccggcg cgccctctcg tgcgccgcgc ctgtcggcgc tgcatctcgt tcccgattcg       240
     ctaggcttcg cgctcgacgg cgccgcgcag gcggtcgacg cggtcgatcg cggcgccgcg       300
     ctgcccgcgg cgctcgccgc cgttcacgca gcgctgcctt cgaacgcgca ggcggcgtcg       360
     cgcggcgcga tccaggacat cgggtatcgt gcgatgcgcc gccgcggcac ggcggactgg       420
     ctgatcgcgc aactcgtcgc gaaggcgccg ccggcgcacg tgcatgcgct tctcgtctgc       480
     gcgttcgcgc tcctcgtcga cgacgagcac gccgcttatg cgcccttcac cgtcgtcgat       540
     caggccgtga ccgcgatcgg cgcgcgccgc gagtgctcgt ttgcgaaggg gctcgtcaac       600
     gcggtgctgc gccggtttct gcgcgagcgg gccgcgtggc tcgagcggct gcaggccgat       660
     cggcgcgcgc tttggaacta cgagccgtgg tggatcgatg ccgtcgagcg cgcgtggccc       720
     gatgcatggc agcgcattct cgccgcgggc gatgcgcccg gcccgctcac gctgcgcgtg       780
     aatgcgcgcc ggatgacggc ggacgcgtat ctcgacacgt tgcgcgccga gcggatcgac       840
     gccgagaaga tcggccttca cgcgatacgg cttgcatcgg cgcggcccgt cgagcgcatt       900
     ccgggcttcg cggacggcat cgtgtcggtg caggacgccg gcgcgcagct ctcggccgaa       960
     tggctcggcg cgcgcgacgg catgcgcgtg ctcgacgcgt gcgcggcgcc cggcggcaag      1020
     acgggccaca ttctcgagct cgcgcacgcc gaggtggtcg cgctcgaaag cgatccggcg      1080
     cgcgcgccgc gcatcggcga gaatctcgcg cggctgtcgc tcacggccga cgtgcgcgtc      1140
     ggcgacgcgg cagaccccgc gcaatggcac gacggacgtc cgttcgaccg ggtcctcgcc      1200
     gatgtgccgt gctccgcgtc gggcatcgtg cgccgccatc cggacatccg ctggctgcgc      1260
     cgcgcggccg acattcccgc gctcgtcgcc gagcagcggc gcatcctgag cgcgctctgg      1320
     ccgctcgtga aacccggcgg agagttgctg tacgtgacct gctcgatctt tccggaagag      1380
     ggcgagctgc aggcgcgctg gtttggagac gcctgtcaag atgcggtacg attggacgcg      1440
     cccgggcagt tgctgccgca gggcgcgaca ggcggggcgc cggccgtcgg gggatcgggc      1500
     gagtccggcc ggcatgtcga tcacgacgga tttttctacg cgcgctttca gaaacggtga      1560
//

If you have problems or comments...

PBIL Back to PBIL home page