(data stored in SCRATCH9089 zone)

EMBL: CP000124.TRME

CP000124.TRME        Location/Qualifiers
FT   CDS_pept        316250..317653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmE"
FT                   /locus_tag="BURPS1710b_0307"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00450; match to protein family HMM
FT                   TIGR00650"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50818"
FT                   /db_xref="GOA:Q3JXI0"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXI0"
FT                   /protein_id="ABA50818.1"
FT                   /translation="MLATDSDPIVAIATASGRGGIGVVRLSLGRAGEAAARALSDALCG
FT                   ARLMPRHASYVPFLDGAGEPLDRGIALYFPAPHSYTGEHVIELQGHGGPIVLQLLLQRC
FT                   LDAGRAHGLRLAEPGEFTRRAFLNDKLDLAQAEAVADLIEASSEAAARSAGRSLDGAFS
FT                   RDIHALVDDVIALRMLVEATLDFPEEEIDFLEAADARGKLAHIRERLAHVLGDARQGAL
FT                   LREGLSVVLAGQPNVGKSSLLNALAGAELAIVTPIAGTTRDKVAQTIQIEGIPLHIIDT
FT                   AGLRETEDEVEKIGIARTWGEIERADVVLHLLDARSGLGPGDEAIAARFPDGVPVVRVL
FT                   NKTDLTGAPASVTRTGGGAARADVCEVRLSAKRGDGIDLLRGELLRIAGWQAGAESVYL
FT                   ARERHLIALRAAQAHLARAAEHAEQNAQALDLFAEELRLAQERLNSITGEFTSDDLLGV
FT                   IFSRFCIGK"
     atgctcgcca ctgattccga tccgatcgtc gccattgcca ccgcgtcagg ccgaggcggg        60
     atcggcgtcg tgcgcctttc gcttgggcga gcgggggaag cggcggcgcg cgcgctgagc       120
     gatgcgctgt gcggtgcgcg actcatgccg aggcatgcga gctacgtgcc gtttctcgac       180
     ggcgcgggcg agccgctcga tcgcggcatc gcgctctatt tccccgcgcc gcattcgtat       240
     acgggcgagc acgtgatcga gctgcaaggc cacggcgggc cgatcgtgct gcagctcttg       300
     ctgcagcgct gcctcgacgc cgggcgtgcg catgggctgc ggctcgctga gccgggcgaa       360
     ttcacgcgcc gggcgttcct gaacgacaag ctcgacctcg cgcaggcgga ggccgtcgcc       420
     gatctgatcg aggcgagctc cgaggcggct gcgcgttcgg cgggccgctc gctcgacggg       480
     gcgttctcgc gcgacatcca tgcgctcgtc gacgacgtga tcgcgctgcg gatgctcgtc       540
     gaggcgacgc tcgattttcc ggaggaggag atcgacttcc tggaggcggc cgacgcgcgc       600
     ggcaagctcg cgcacatccg cgagcggctc gcgcacgtgc tcggcgacgc gcggcagggg       660
     gcgttgttgc gcgaggggct atcggtcgtg cttgccgggc agccgaacgt cggcaagtcg       720
     tcgctgttga atgcgcttgc gggcgcggaa ctggcgatcg tcacgccgat cgccggcacg       780
     acgcgcgaca aggttgcgca gacgattcag atcgagggca ttccgttgca cattatcgat       840
     acggcgggct tgcgcgaaac ggaggacgag gtcgagaaga tcggcatcgc gcgcacgtgg       900
     ggcgagatcg agcgggcgga cgtcgtgctg cacctgctcg atgcgagaag cgggcttggc       960
     ccgggcgacg aggcgatcgc cgcgcgcttc ccggacggcg tgccggtggt gcgcgtgctg      1020
     aacaagacgg atctgacggg cgcgccggca tcggtgacgc ggacaggcgg cggcgcggcg      1080
     cgcgcggacg tatgtgaagt gcggctgtcg gcgaagcgcg gcgacgggat cgatttgctg      1140
     cgcggcgagc tgctgcggat cgccggttgg caggcgggtg cggaaagcgt gtatctcgcc      1200
     cgcgagcggc atctgatcgc gctgcgcgcg gcgcaggcgc atctcgcgcg ggcggcggag      1260
     cacgcggagc agaatgcgca ggcgctggat ctcttcgccg aggaactgcg gctcgcgcag      1320
     gagcggctta attcgatcac cggggagttt acgtccgatg atttgttggg ggtgattttt      1380
     agtcggtttt gtatcggaaa ataa                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page