(data stored in SCRATCH9089 zone)

EMBL: CP000124.VIOA

CP000124.VIOA        Location/Qualifiers
FT   CDS_pept        97841..98989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vioA"
FT                   /locus_tag="BURPS1710b_0095"
FT                   /product="aminotransferase, DegT/DnrJ/EryC1/StrS family"
FT                   /note="identified by match to protein family HMM PF01041;
FT                   match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50137"
FT                   /db_xref="GOA:Q3JY41"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY41"
FT                   /protein_id="ABA50137.1"
FT                   /translation="MSALPLRAVEPWIDERIFVTQPHLAPLAEFLPYLEAIWESKVLTN
FT                   GGPFHQQLEKALCDYLGVRHLALFTNGTLALVTALQALRITGEVITTPYSFVATAHSLL
FT                   WNGIKPVFVDIDPSTLNLDPAKIEAAITPQTTAIMPVHCYGRPCDVAAIQKIADNYNLK
FT                   VIYDAAHAFGVKTPDGSVLEHGDMSILSFHATKVFNTFEGGAIVCPDAKTKQHIDHLKN
FT                   FGFVDEVTVVAAGINGKMSEINAAFGLLQLKHIDDALARRAKIDAAYRDALARVPGIRC
FT                   LPPVDAPVANHSYFPILVGDDYPMSRDALYQRLRDHQIYARRYFYPLISDFPMYRGLPS
FT                   AQRGNLPVAADAAARVLCLPIYPALSDASLERIVSLMAGAHA"
     atgagcgcac tgccgctgcg cgccgtcgaa ccgtggatcg acgagcgcat ctttgtcacc        60
     caaccgcatc tcgcgccgct cgccgaattc ctgccttatc tcgaggcgat ctgggaaagc       120
     aaggtgctga cgaacggcgg gccgttccat cagcagctcg agaaggcgct gtgcgactac       180
     ctcggcgtgc gtcacctcgc gctcttcacg aacggcacgc tcgcgctcgt cacggcgctt       240
     caggcgctgc gcatcacggg cgaagtgatc acgacgccgt attcgttcgt cgcgaccgcg       300
     cactcgctgc tgtggaacgg gatcaagccg gtgttcgtcg acatcgatcc gagcacgctg       360
     aatctcgatc ccgcgaagat cgaggcggcg atcacgccgc agacgaccgc gatcatgccc       420
     gtgcactgct atggccggcc gtgcgacgtc gccgcgatcc agaaaatcgc cgacaactac       480
     aatctgaagg tgatctatga cgccgcgcat gcattcggcg tgaagacgcc cgacggcagc       540
     gtgctcgagc acggcgacat gtcgatcctg agctttcacg cgacgaaggt attcaacacg       600
     ttcgaaggcg gcgcgatcgt ctgcccggac gcgaagacga agcagcacat cgatcacctg       660
     aagaacttcg gcttcgtcga cgaagtcacc gtcgtcgcgg cgggaatcaa cggcaagatg       720
     agcgagatca acgcggcatt cggtctgctg cagctcaagc acatcgacga tgcgctcgcg       780
     cgccgcgcga agatcgacgc cgcataccgc gacgcgctcg cccgcgtgcc cggcatccgt       840
     tgcctgccgc ccgtcgacgc gccggtcgcg aatcattcgt acttcccgat tctcgtcggc       900
     gacgactacc cgatgagtcg cgacgcgctg taccagcgcc tgcgcgacca ccagatctac       960
     gcacgccgct atttctaccc gctcatctcc gatttcccga tgtatcgcgg gctgccgtcc      1020
     gcgcagcgcg gcaatctgcc cgtcgccgcc gacgccgccg cgcgcgtgct gtgcctgccg      1080
     atctatccgg cgctgtccga tgcatcgctc gagcgaatcg tatcgctgat ggcgggagcg      1140
     catgcatga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page