(data stored in SCRATCH9089 zone)

EMBL: CP000124.WRBA

CP000124.WRBA        Location/Qualifiers
FT   CDS_pept        26055..26849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wrbA"
FT                   /locus_tag="BURPS1710b_0022"
FT                   /product="flavodoxin domain protein"
FT                   /note="identified by match to protein family HMM PF00258"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48528"
FT                   /db_xref="GOA:Q3JYB3"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYB3"
FT                   /protein_id="ABA48528.1"
FT                   /translation="MNLESRACRENGRSLRFASFRKFSRARQRSSTMLRPARLFPPAVR
FT                   APSRARTSFAARAARARAVSSSHLGEKGMSNLVIVYHSGYGHTKKLAESVLAGAREAGA
FT                   NARLVAVGDLDDAGWAALDAADAIVFGAPTYMGGPSADFKKFADATSKAWFGQKWKDKI
FT                   AAGFTNSASMNGDKFSTIQYFVTLAMQHGMVWVGTGLLPANTKAATRDDLNYAGGFTGL
FT                   LAQSPSDASPDEAPAGGDLGTAKAFGARVATATARWLAGNGR"
     atgaacctcg agtcgagggc gtgccgcgag aacggccgct cgctgcgatt cgcttcgttc        60
     aggaaattca gtcgtgcgcg acagcgatcg tccacgatgt tgcgccccgc tagacttttt       120
     ccgccagccg ttcgcgcacc cagccgcgca cggacatcgt tcgccgcgcg ggccgcccgg       180
     gcgcgcgcgg tttcgtcgtc tcaccttgga gaaaagggca tgtcgaacct cgtcatcgtt       240
     taccacagcg gctacggcca cacgaagaaa ctcgccgaat cggtgctcgc gggcgcgcgg       300
     gaagccgggg cgaacgcgcg gctcgtcgcc gtcggcgatc tcgacgacgc cggctgggcc       360
     gccctcgatg ccgccgacgc gatcgtcttc ggcgcgccga cttacatggg cgggccatcg       420
     gccgacttca agaaattcgc cgacgcgacg tcgaaagcgt ggttcggcca gaaatggaag       480
     gacaagatcg cggcgggctt cacgaactcc gcctcgatga acggcgacaa gttctcgacg       540
     attcaatatt tcgtcacgct cgcgatgcag catgggatgg tatgggtcgg cacgggcctg       600
     ctgcccgcga acacgaaggc ggcgacgcgc gacgacctca actacgcggg cggcttcacg       660
     gggctgctcg cgcaatcgcc gtccgacgcg tcgccggacg aggcgcccgc cggcggcgat       720
     ctcggcaccg cgaaggcgtt cggcgcgcgc gtcgcgacgg ccaccgcccg ctggctcgcc       780
     ggcaacggcc gatga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page