(data stored in ACNUC7421 zone)

EMBL: CP000247.PE101

CP000247.PE101       Location/Qualifiers
FT   CDS_pept        112362..112760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0101"
FT                   /product="mutator MutT protein"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68141"
FT                   /db_xref="GOA:A0A454A0Y8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0Y8"
FT                   /protein_id="ABG68141.1"
FT                   /translation="MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKVEMGET
FT                   PEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVESWEGEPWGKEGQPGEW
FT                   MSLVGLNADDFPPANEPVIAKLKRVYAG"
     atgaaaaagc tgcaaattgc ggtaggtatt attcgcaacg agaacaatga aatctttata        60
     acgcgtcgcg cagcagatgc gcacatggcg aataaactgg agtttcccgg cggtaaagtt       120
     gaaatgggcg aaacgccgga acaggcggtg gtgcgtgaac ttcaggaaga agtcgggatt       180
     accccacaac atttttcgct atttgaaaaa ctggaatatg aattcccgga caggcatata       240
     actctgtggt tctggctggt cgaaagctgg gaaggggagc cgtggggtaa agaagggcaa       300
     cccggtgagt ggatgtcgct ggtcggtctt aatgccgatg attttccgcc agccaatgaa       360
     ccggtaattg cgaaacttaa gcgtgtgtat gccggataa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page