(data stored in ACNUC7421 zone)

EMBL: CP000247.PE103

CP000247.PE103       Location/Qualifiers
FT   CDS_pept        complement(113055..113798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0103"
FT                   /product="hypothetical protein YacF"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68143"
FT                   /db_xref="GOA:Q0TLN8"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TLN8"
FT                   /protein_id="ABG68143.1"
FT                   /translation="MQTQVLFEHPLNEKMRTWLRIEFLIQQLTVNLPIVDHAGALHFFR
FT                   NVSELLDVFERGEVRTELLKELDRQQRKLQTWIGVPGVDQSRIEALIQQLKAAGSVLIS
FT                   APRIGQFLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLPQAQRDSQVETWIASLNP
FT                   LTQALTMVLDLIRQSAPFRKQTSLNGFYQDNGGDADLLRLNLSLDSQLYPQISGHKSRF
FT                   AIRFMPLDSENGQVPERLDFELACC"
     atgcagaccc aggtcctttt tgaacatcca ctaaatgaaa aaatgcgtac atggctgcgc        60
     attgagtttt tgattcagca actcaccgtt aatctaccca tcgttgacca cgctggcgcg       120
     ctgcatttct tccgtaatgt cagtgaatta ctggatgttt tcgagcgcgg cgaagtccgc       180
     actgagctgt tgaaagaact tgaccggcag caacgtaaac tccagacctg gattggcgtg       240
     cccggcgtgg accagagccg tattgaagca ttaattcagc agttaaaagc ggcggggagc       300
     gtattaatct ccgcgccgcg tatcgggcaa tttctacgtg aagatcgttt gattgctctg       360
     gtgcgtcagc gactgagcat cccgggcggc tgttgcagct ttgatttacc tacattgcac       420
     atttggctgc atctacctca ggcgcagcgc gacagccagg tagaaacctg gattgccagc       480
     ctgaacccac ttacccaggc acttaccatg gtgctggatt taattcgcca gtcggccccc       540
     ttccgtaaac aaaccagcct gaatggtttt tatcaggata acggtggcga tgccgacttg       600
     ctgcgcctga atctgtcgct cgattcacag ctttatccgc aaatttccgg tcataagagc       660
     cgttttgcca ttcgttttat gccgctggac agtgaaaacg gacaggtacc agaacgtctg       720
     gatttcgaac tggcctgttg ctaa                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page