(data stored in ACNUC7421 zone)

EMBL: CP000247.PE112

CP000247.PE112       Location/Qualifiers
FT   CDS_pept        complement(121378..122748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0112"
FT                   /product="aromatic amino acid transport protein AroP"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68152"
FT                   /db_xref="GOA:A0A454A0Z2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0Z2"
FT                   /protein_id="ABG68152.1"
FT                   /translation="MEGQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAGP
FT                   GIILGYAIAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGSFAGFASGWNYWVLYVL
FT                   VAMAELTAVGKYIQFWYPEIPTWVSAAVFFVVINAINLTNVKVFGEMEFWFAIIKVIAV
FT                   VAMIIFGAWLLFSGNGGPQASVSNLWDQGGFLPHGFTGLVMMMAIIMFSFGGLELVGIT
FT                   AAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLMPWTRVTADTSPFVLIFHELGDT
FT                   FVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALASVDKRGVPVNTILVSA
FT                   LVTALCVLINYLAPESAFGLLMALVVSALVINWAMISLAHMKFRRAKQEQGVVTRFPAL
FT                   LYPLGNWVCLLFMAAVLVIMLMTPGMAISVYLIPVWLIVLGIGYLFKEKTAKAVKAH"
     atggaaggtc aacagcacgg cgagcagcta aagcgcggcc ttaaaaaccg ccatattcag        60
     cttatcgcgc tgggtggcgc gatagggaca gggctattcc tgggtagcgc ctccgtaata       120
     cagtccgcag ggccagggat tatcctgggt tacgccattg ctggttttat cgcctttctg       180
     atcatgcgtc agctaggtga aatggtggtc gaagaacctg tcgcaggctc ctttagccac       240
     tttgcttata aatactgggg cagttttgcc ggtttcgcct ctggctggaa ctactgggta       300
     ctgtacgttt tagttgccat ggcagagctg actgccgtgg gtaaatacat tcagttctgg       360
     tatccggaaa tcccaacctg ggtttctgcc gccgtgttct ttgtggtgat caacgccatc       420
     aacctgacaa acgtaaaagt gtttggcgag atggagttct ggtttgccat tatcaaagtt       480
     atcgcggtgg tagcgatgat catcttcggc gcctggctgc tattcagcgg caacggcggc       540
     ccgcaggcga gcgttagcaa cctgtgggat cagggtggtt tcctgccaca cggcttcacc       600
     ggtctggtga tgatgatggc gattatcatg ttctctttcg gtggtctgga actggtgggg       660
     atcaccgcag cagaagctga taacccggag caaagtatcc cgaaagcaac taaccaggtt       720
     atctaccgca tcctgatttt ctatattggc tcgttagccg ttctgctctc actaatgccg       780
     tggacccgcg ttaccgccga taccagtccg tttgtgctga tcttccacga gttaggcgat       840
     acctttgtag cgaatgcgct gaatatcgtg gtactgactg ctgcgctctc cgtgtacaac       900
     agctgcgtat attgcaacag ccgtatgctg ttcggtctgg cacaacaagg gaacgcgcca       960
     aaagcgctgg cgtctgtcga taaacgcggc gtaccggtta acactattct ggtgtctgcg      1020
     ctggttacgg cattgtgcgt actgattaac taccttgccc cagagtccgc tttcggactg      1080
     ttaatggcgc tggtggtatc tgcactggtc atcaactggg cgatgatcag tctggcgcat      1140
     atgaaattcc gtcgagccaa acaagaacaa ggcgtggtaa ctcgcttccc tgccctgctt      1200
     tatccgctgg gtaactgggt ctgcctgctg tttatggcgg cggtactggt gattatgctg      1260
     atgaccccag gaatggcgat ttcggtatac ctgatcccgg tatggctgat cgtgttaggt      1320
     atcggctatc tgtttaaaga gaaaaccgcc aaagccgtaa aagcgcatta a               1371
//

If you have problems or comments...

PBIL Back to PBIL home page