(data stored in ACNUC7421 zone)

EMBL: CP000247.PE114

CP000247.PE114       Location/Qualifiers
FT   CDS_pept        125060..125344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0114"
FT                   /product="colicin immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68154"
FT                   /db_xref="GOA:A0A454A0Y7"
FT                   /db_xref="InterPro:IPR000290"
FT                   /db_xref="InterPro:IPR035900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0Y7"
FT                   /protein_id="ABG68154.1"
FT                   /translation="MFKEKLEDYTEEEFLNFLGGLRSTMKDGKPLKGKELEMYWDSLVD
FT                   HFIEITQHPSGSDLIFYPKSQGDDKPENILKIVKEWRRSQGLPLFKDSK"
     atgtttaaag aaaagctcga agattatacc gaggaggaat ttcttaattt tttaggcgga        60
     ttgagatcaa ctatgaaaga tggaaagccc ttaaaaggta aggagctaga aatgtactgg       120
     gattcattag tagatcattt tattgaaatt acacagcatc cgtcagggag cgatctcatt       180
     ttctacccta aaagtcaagg agatgataag cctgaaaaca tcctgaaaat tgtcaaagaa       240
     tggcggcgtt cacaggggtt acccttgttt aaagactcta aataa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page