(data stored in ACNUC7421 zone)

EMBL: CP000247.PE126

CP000247.PE126       Location/Qualifiers
FT   CDS_pept        139450..139812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0126"
FT                   /product="hypothetical UPF0231 protein YacL"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68166"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TLL5"
FT                   /protein_id="ABG68166.1"
FT                   /translation="MDYEFLRDITGVVKVRMSMGHEVIGHWFNEEVKENLALLDEVEDA
FT                   ARTLKGSERSWQRAGHEYTLWMDGEEVMVRANQLEFAGDEMEEGMNYYDEESLSLCGVE
FT                   DFLQVVAAYRNFVQQK"
     atggattacg aatttctgcg cgatattacc ggagtggtaa aggtgcgcat gtccatgggg        60
     catgaagtca tcgggcactg gtttaatgaa gaggtgaaag aaaacctggc cttgcttgat       120
     gaagtggaag acgcagcgcg cacgctcaaa ggcagcgaac gatcctggca gcgggcaggg       180
     catgaataca cgctatggat ggacggtgaa gaggtgatgg ttcgcgccaa tcaactggaa       240
     ttcgctggcg atgaaatgga agaggggatg aactactacg atgaagagag cttgtcgctg       300
     tgcggcgttg aggattttct tcaggtggtg gcggcttacc gtaatttcgt gcagcagaag       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page