(data stored in ACNUC7421 zone)

EMBL: CP000247.PE13

CP000247.PE13        Location/Qualifiers
FT   CDS_pept        complement(11451..11855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0013"
FT                   /product="hypothetical protein YaaI precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68055"
FT                   /db_xref="InterPro:IPR020240"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TLX6"
FT                   /protein_id="ABG68055.1"
FT                   /translation="MKSVITISASLAISLMLCCTAQANDHKILGVIAMPRNETNDLALK
FT                   LPVCRIVKRIQLSADHGDLQLSGASIYFKATRSASQTLNIPSEIKEGQTTDWININSDN
FT                   DNKRCVSKITFSGHTVNSSDMATLKIIGDD"
     atgaaatccg ttattacgat ttccgccagc ctggcgatta gcctgatgct gtgctgcacg        60
     gcgcaggcaa acgaccataa aatcctcggc gtcattgcaa tgccgcgaaa cgaaaccaac       120
     gatctggcgc tgaaacttcc tgtttgtcgc attgttaaac gcatacagct ctcagccgac       180
     catggcgatt tgcagttaag cggtgcatcg atttatttca aagccacccg aagcgccagt       240
     cagaccctga atattccttc agaaataaaa gaagggcaaa ccactgactg gatcaacatt       300
     aacagcgata acgacaacaa acgctgcgtc tcaaaaatca ccttttccgg tcatacagtg       360
     aactcatcgg atatggccac gctgaaaatt atcggcgacg actaa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page