(data stored in ACNUC7421 zone)

EMBL: CP000247.PE131

CP000247.PE131       Location/Qualifiers
FT   CDS_pept        complement(143685..143867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A128"
FT                   /protein_id="ABG68171.1"
FT                   /translation="MRFVRAGCGVNALSGLQNICKFNTLRVGLISVAHQAVLRLSSVSC
FT                   PERSGHISEYGLFIP"
     gtgcgctttg ttcgtgccgg atgcggcgtg aacgccttat ccggcctaca aaacatttgc        60
     aaattcaata cattgcgcgt aggcctgata agcgtagcgc atcaggcagt tttgcgtttg       120
     tcatcagttt catgcccgga gagatccggg catatttccg aatacggtct ttttataccg       180
     taa                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page