(data stored in ACNUC7421 zone)

EMBL: CP000247.PE148

CP000247.PE148       Location/Qualifiers
FT   CDS_pept        complement(157695..158261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0148"
FT                   /product="hypothetical protein YadM precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68188"
FT                   /db_xref="GOA:A0A454A121"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A121"
FT                   /protein_id="ABG68188.1"
FT                   /translation="MIKITPHKITILMGLLLSPSVFATDVNVDFTATVKATTCNITLTG
FT                   TNVTDNGNDKYTLVIPSMGMDKIANKTAQSEANFKLVANGCSSGISWIDTTLTGNQSGS
FT                   SPALIIPLASDTTSTTSYIGMGFKRKATSGDTFLKPNSAEYIRWSASEISTDGLEMTVA
FT                   LRETSVGKGVPGKFRALATFNFSYQ"
     atgataaaaa tcacaccaca taaaataaca atactcatgg gactattgtt atcgccttcg        60
     gtatttgcaa cggatgttaa tgtcgatttt accgctaccg tgaaagcaac aacctgtaat       120
     attacactta ccggaactaa tgtcactgat aatggaaatg ataagtacac cttagttatt       180
     ccctcgatgg gaatggataa aatagccaat aaaacagcac aatctgaagc caactttaaa       240
     ttggtagcca atggatgcag cagtggaatt agctggattg atacaaccct gacaggaaat       300
     caatcaggaa gttcacccgc gctaattatc cccctggcca gtgatacaac ctccaccaca       360
     agctatatcg gaatgggatt taaaaggaag gcgacttcag gcgatacatt tctgaaacct       420
     aatagcgcag aatatatacg ttggagtgca tcagaaatta gcaccgatgg acttgagatg       480
     actgtcgcac tgcgtgaaac aagtgtaggg aaaggtgttc caggcaagtt tcgcgcactg       540
     gcaactttta acttcagcta tcaataa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page