(data stored in ACNUC7421 zone)

EMBL: CP000247.PE15

CP000247.PE15        Location/Qualifiers
FT   CDS_pept        14202..15362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0015"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68057"
FT                   /db_xref="GOA:A0A454A0U4"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0U4"
FT                   /protein_id="ABG68057.1"
FT                   /translation="MHSSRGNLKKMAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPD
FT                   RNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGGMGGGGFGGGADFSDIF
FT                   GDVFGDIFGGGRGRQRAARGADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAK
FT                   PGTQPQTCPTCHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTL
FT                   SVKIPAGVDTGDRIRLAGEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINF
FT                   AMAALGGEIEVPTLDGRVKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETP
FT                   VGLNEKQKQLLQELQESFGGPTGEHNSPRSKSFFDGVKKFFDDLTR"
     gtgcattcat ctaggggcaa tttaaaaaag atggctaagc aagattatta cgagatttta        60
     ggcgtttcca aaacagcgga agagcgtgaa atcaaaaagg cctacaaacg cctggccatg       120
     aaataccacc cggaccgtaa ccagggtgac aaagaggccg aggcgaaatt taaagagatc       180
     aaggaagctt atgaagttct gaccgactcg caaaaacgtg cggcatacga tcagtatggt       240
     catgctgcgt ttgagcaagg tggcatgggc ggcggcggtt ttggcggcgg cgcagacttc       300
     agcgatattt ttggtgacgt tttcggcgat atttttggcg gcggacgtgg tcgtcaacgt       360
     gcggcgcgcg gtgctgattt acgctataac atggagctca ccctcgaaga agctgtacgt       420
     ggcgtgacca aagagatccg cattccgact ctggaagagt gtgacgtttg ccacggtagc       480
     ggtgcaaaac caggtacaca gccgcagacc tgtccgacct gtcatggttc tggccaggtg       540
     cagatgcgcc agggtttctt tgccgtgcag cagacctgtc cacactgtca gggccgcggt       600
     acgctgatca aagatccgtg caacaaatgt catggtcatg gtcgtgttga gcgcagcaaa       660
     acgctgtccg ttaaaatccc ggcaggggtg gacactggag accgcatccg tcttgcgggc       720
     gaaggtgaag cgggtgaaca cggcgcaccg gcaggcgatc tgtacgttca ggttcaggtt       780
     aaacagcacc cgattttcga gcgtgaaggc aacaacctgt attgcgaagt cccgatcaac       840
     ttcgctatgg cggcgctggg tggtgaaatc gaagtaccga cccttgatgg tcgcgtcaaa       900
     ctgaaagtgc ctggcgaaac ccagaccggt aagctgttcc gtatgcgcgg taaaggcgtc       960
     aagtctgtcc gcggtggcgc acagggtgat ttgctatgcc gcgttgttgt cgaaacaccg      1020
     gtaggtttga acgagaagca gaaacagctg ctgcaagagc tgcaagaaag ctttggtggc      1080
     ccaaccggcg agcacaacag cccgcgttca aagagcttct ttgatggcgt gaagaagttt      1140
     tttgacgacc tgactcgcta a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page