(data stored in ACNUC7421 zone)

EMBL: CP000247.PE150

CP000247.PE150       Location/Qualifiers
FT   CDS_pept        complement(160901..161641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0150"
FT                   /product="chaperone protein EcpD precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68190"
FT                   /db_xref="GOA:A0A454A123"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A123"
FT                   /protein_id="ABG68190.1"
FT                   /translation="MFFNTKHTAALCLASCMAFSSSAIADIVISGTRVVYKSEQKNVNV
FT                   RLENKGNNPLLVQSWLDTGDDNAEPGSITVPFTATPPVSRIDAKRGQTIKLMYTASSAL
FT                   PKDRESVFWFNVLEVPPKPDAAKAANQSLLQLAFRTRIKLFYRPEGLSGISSDAPLALK
FT                   WSWATSEGKAALRVDNPTPYYVSFSSGDLEANGKRYPLDMTMIAPFSNDVIKVNGMSGR
FT                   TSSAKVHFFAINDFGGSIEGNANL"
     atgtttttta atactaaaca taccgcagca ttgtgcttag cgagctgtat ggcttttagc        60
     tcatcagcta ttgcagacat cgtaatttca ggtacacgcg tagtttataa aagcgaacaa       120
     aaaaacgtca atgtacgtct ggaaaataaa ggcaataacc cattgctggt tcagagttgg       180
     ttagatactg gcgatgacaa cgctgaacca ggcagtatta ctgtcccctt taccgctacg       240
     ccgccagtat cacgtattga tgctaaacgt ggccaaacaa tcaaactgat gtacaccgcc       300
     agcagtgctc tgccaaaaga cagagaaagt gtgttctggt ttaacgtact ggaagtacct       360
     ccaaaaccag atgcagcaaa agcagcaaac caaagcctgc tacaactggc atttcgcaca       420
     cgtataaaac tgttctatcg cccggaagga ttgagtggaa tttcatctga tgcaccattg       480
     gctctgaagt ggtcctgggc aacatctgaa ggcaaagcag cattacgcgt tgataaccct       540
     acgccctact atgtctcttt tagcagtggt gatttagaag ccaacggcaa acgctacccc       600
     ctggatatga caatgattgc gccgttcagt aacgacgtca tcaaggtaaa tgggatgagt       660
     ggcagaacaa gctctgcaaa agtgcatttt ttcgccatta atgattttgg tggatctatt       720
     gaaggcaacg ccaaccttta a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page