(data stored in ACNUC7421 zone)

EMBL: CP000247.PE162

CP000247.PE162       Location/Qualifiers
FT   CDS_pept        175922..176812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0162"
FT                   /product="ferrichrome-binding periplasmic protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68202"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A144"
FT                   /protein_id="ABG68202.1"
FT                   /translation="MSGLPLISRRRLLTAMALSPFLWQMNTAHAAVIDPNRIVALEWLP
FT                   VELLLALGIVPYGVADTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLTHYEDFIR
FT                   SMKPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAV
FT                   SIDRLAAYKDVDVLCFDHDNSKDMNALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSA
FT                   MHFVRILDNAIGGKA"
     atgagcggct tacctcttat ttcgcgccgc cgactgttaa cggcgatggc gctttctccg        60
     ttcttatggc agatgaatac cgcccacgcg gcagttattg atcccaatcg tattgtggca       120
     ctggagtggt tgccggtgga gttactgctg gcgctcggca tcgtgcctta cggcgtggcg       180
     gacaccatca actatcgcct gtgggtcagc gaaccgccat tgccggactc agtgattgac       240
     gttggtttgc gtacagaacc caaccttgaa ctgctgaccg aaatgaaacc gtcgtttatg       300
     gtctggtctg caggatatgg cccttcacca gaaatgctgg cacgtattgc gccggggcgc       360
     ggatttaact tcagcgacgg caaacagcca ctggcgatgg cgcgtaaatc actgacggaa       420
     atggcagatt tacttaacct gcaaagcgca gcggaaacgc atttaacgca ctatgaagac       480
     tttatccgca gcatgaaacc ccgctttgtg aagcgtggtg cacgcccgtt attgctgacg       540
     acgcttatcg atccgcgcca tatgttggtc ttcggtccaa acagcttgtt ccaggaaatt       600
     ctcgatgagt acggcatccc aaatgcctgg caaggggaaa ccaacttctg gggcagtacc       660
     gccgtcagta tcgatcgtct ggcggcgtat aaagacgttg atgtgctctg ttttgatcac       720
     gacaacagca aagacatgaa tgcgctaatg gcaaccccgc tgtggcaggc catgccgttt       780
     gtccgcgccg gacgctttca gcgcgttccg gcggtctggt tctatggcgc gacgctttcg       840
     gcaatgcact ttgtgcgtat tctggataac gccatcggag gtaaagcgtg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page