(data stored in ACNUC7421 zone)

EMBL: CP000247.PE163

CP000247.PE163       Location/Qualifiers
FT   CDS_pept        176809..178791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0163"
FT                   /product="ferrichrome transport system permease protein
FT                   FhuB"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68203"
FT                   /db_xref="GOA:A0A454A151"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A151"
FT                   /protein_id="ABG68203.1"
FT                   /translation="MSKRIALFPALLLALLVVAASALTWMNSSQALPRSQWAQAAWSPD
FT                   IDVIEQMIFHYSLLPRLAISLLVGAGLGLVGVLFQQVLRNPLAEPTTLGVATGAQLGIT
FT                   VTTLWAIPGAMASQFAALAGACVVGLIVFGVAWGKRLSPVTLILAGLVVSLYCGAINQL
FT                   LVIFHHDQLQSMFLWSTGTLTQTDWGGVERLWPQLLGGVMLTLLLLRPLTLMGLDDGVA
FT                   RNLGLALSLARLAALSLAIVISALLVNAVGIIGFIGLFAPLLAKMLGARRLLPRLMLAS
FT                   LIGALILWLSDQIILWLTRVWMEVSTGSVTALIGAPLLLWLLPRLRSISAPDMKVNDRV
FT                   ATERQHVLAFALAGGVLLLMAVVVALSLGRDAHGWTWASGALLEDLMPWRWPRIMAALF
FT                   AGVMLAVAGCIIQRLTGNPMASPEVLGISSGAAFGVVLMLFLVPGNAFGWLLPAGSLGA
FT                   AVTLLIIMIAAGRGGFSPHRMLLAGMALSTAFTMLLMMLQASGDPRMAQVLTWISGSTY
FT                   NATDAQVWRTGIVMVILLAITPLCRRWLTILPLGGDTARAVGMALTPTRIALLLLAACL
FT                   TATATMTIGPLSFVGLMAPHIARMMGFRRTMPHIVISALVGGLLLVFADWCGRMVLFPF
FT                   QIPAGLLSTFIGAPYFIYLLRKQSR"
     gtgagtaaac gaattgcgct tttcccggcg ttattgctgg cgctgctggt ggttgccgca        60
     tcggcgctca cctggatgaa ctcctcgcag gcgctgccgc gcagccagtg ggcgcaggcc       120
     gcctggtcgc cggatattga cgtcatcgag cagatgattt ttcactacag cttgctgccg       180
     cgtctggcga tttcgctgct ggtgggcgcg ggcctggggc tggtgggcgt gctgtttcag       240
     caagtgctgc gtaacccgct ggcggaaccg acgacgttgg gcgttgctac aggcgcgcaa       300
     ctggggatta ccgtcacgac gctctgggcg atccccggcg cgatggcgag ccagtttgct       360
     gcgctggcgg gcgcttgcgt tgttggctta atcgtctttg gcgtcgcgtg ggggaaacgg       420
     ctttcgccgg taacgctgat cctcgcgggg ctggtggtga gcctttattg tggggcaatc       480
     aatcagttac tggttatctt ccatcatgac caactgcaaa gcatgttcct gtggagcacc       540
     ggaacactga cgcaaaccga ctggggcggc gttgagcgtt tatggccgca gctgctgggc       600
     ggcgtgatgc tgacgttatt gctacttcgc ccgttaactc tgatggggct tgatgatggc       660
     gtggcgcgca atctcgggct ggccttgtcg ctcgctcgtc tggcggcgtt gtcgctggcg       720
     attgtcatca gtgcgctgct ggtgaacgcg gtggggatta tcggctttat cgggttgttc       780
     gcgccactgc tggcgaaaat gctgggggcg cggcgtttgt tgccacggtt gatgctggca       840
     tcgctgattg gtgcgttaat tctgtggctt tctgatcaaa tcatcctctg gctgactcgc       900
     gtgtggatgg aagtgtccac cggttcggtc actgcgttga tcggtgcgcc gctgctactg       960
     tggttgctgc cgcgtttacg cagcattagc gcgccggata tgaaggtgaa cgatcgtgtc      1020
     gcgactgaac gccaacacgt gctggcgttt gccctcgcgg gcggcgtgct gctgttgatg      1080
     gctgtggtgg tggcgctgtc gttgggtcgt gatgcgcacg gctggacgtg ggcgagcggg      1140
     gcgttgctcg aggatttgat gccctggcgc tggccgcgaa ttatggctgc gctgtttgcg      1200
     ggcgtcatgc tggcggtggc gggctgtatt attcagcggc tgaccggaaa cccgatggca      1260
     agcccggaag tgctggggat tagctccggc gcggcgtttg gcgtggtgtt aatgctgttt      1320
     ctggtgccgg gtaatgcctt tggctggctg ttacccgcag gcagtctcgg ggcggcggtg      1380
     acgctgttga tcattatgat cgccgccgga cgtggtggat tttccccaca ccgcatgtta      1440
     ctggcgggaa tggcgttaag taccgcgttc accatgcttt tgatgatgtt gcaggcaagt      1500
     ggtgacccgc gaatggcgca agttctgacc tggatttccg gttcgaccta caacgcgacc      1560
     gatgcgcagg tctggcgtac cggaattgtg atggtgattt tgctggcgat taccccgctg      1620
     tgccgccgct ggctgaccat tttaccgctg ggtggtgata ccgcacgagc cgtggggatg      1680
     gcgctgacgc cgacgcgaat tgcgctgctg ctgttagcgg cttgcctgac ggcgaccgcg      1740
     acaatgacca ttggaccgtt gagttttgtt ggtttaatgg caccgcatat tgcgcggatg      1800
     atgggctttc gacggacgat gccacacatc gtaatttcgg cgctggtggg tggtttactg      1860
     ctggtgttcg ctgactggtg tgggcggatg gtattgtttc cattccagat cccggcgggg      1920
     ctgctgtcga cctttatcgg cgcgccatat tttatctatt tgttgagaaa gcagagccgt      1980
     taa                                                                    1983
//

If you have problems or comments...

PBIL Back to PBIL home page