(data stored in ACNUC7421 zone)

EMBL: CP000247.PE167

CP000247.PE167       Location/Qualifiers
FT   CDS_pept        complement(182225..182848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0167"
FT                   /product="putative membrane protein YadS"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68207"
FT                   /db_xref="GOA:A0A454A131"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A131"
FT                   /protein_id="ABG68207.1"
FT                   /translation="MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGT
FT                   IRDMALDHGPVFWVKDPTDLVVAMVTSMLTIVLVRQPRRLPKWMLPVLDAVGLAVFVGI
FT                   GVNKAFNAEAGPLIAVCMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHAT
FT                   AYYTFSVPLETASMMGMVVTLLIRLAAIRWHLKLPTFALDENGR"
     atgctcgtct attggctgga tatagtcggc acagcggtat ttgctatctc tggcgttttg        60
     ttagccggaa aattgcgtat ggaccctttt ggcgttctgg tattgggcgt ggttaccgca       120
     gtaggcggcg gaacaattcg cgacatggcg ctggatcacg gcccggtatt ttgggtgaaa       180
     gatcccaccg atctggtcgt tgcaatggtc accagcatgc tgaccatcgt gctggtgcgc       240
     cagccaagac gcttaccaaa atggatgttg ccggtgctgg acgccgttgg tctggcggtg       300
     tttgtcggca ttggcgtgaa taaagccttt aatgcggaag ccggtccgtt aatcgcggtt       360
     tgtatgggcg tcattactgg cgttggcggc gggatcattc gtgatgtact ggcccgcgaa       420
     atccccatga ttttacgtac agaaatctac gccactgcct gtattatcgg cggtattgtc       480
     cacgctacgg cttattacac attttccgta ccactggaaa cagccagtat gatgggcatg       540
     gtcgtgacgc tattgattcg gctggcggct attcgttggc atcttaagct accgacgttt       600
     gcgctggatg agaatggtcg ttga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page