(data stored in ACNUC7421 zone)

EMBL: CP000247.PE168

CP000247.PE168       Location/Qualifiers
FT   CDS_pept        complement(183071..183688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0168"
FT                   /product="periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68208"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A139"
FT                   /protein_id="ABG68208.1"
FT                   /translation="MAKSLFRALVALSFLAPLWLNAAPRVITLSPANTELAFAAGITPV
FT                   GVSSYSDYPPQAQKIGQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKV
FT                   MWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFG
FT                   INPPFTQWKRVDSEPGTRSFVAEKTSLKTAGFPGRKLAANRC"
     atggctaagt cactgttcag ggcgctggtc gccctgtctt ttctcgcgcc gctgtggctc        60
     aatgccgcgc cgcgcgtcat cacgctttct cccgccaaca ctgaacttgc ctttgccgcc       120
     gggatcacgc cggttggggt cagcagctat tccgactatc ctccacaagc gcaaaagatt       180
     gggcaggttt ccacctggca ggggatgaat ctggaacgca ttgtcgcgct gaaacccgat       240
     ctggtgattg cctggcgtgg aggtaatgcc gagcggcagg ttgaccagct ggcttcgctg       300
     ggaataaaag tgatgtgggt cgatgcgaca agcattgaac aaattgccaa tgcgttacgt       360
     caactggccc cctggagtcc gcaaccggat aaggccgaac aagccgcgca atccctgctg       420
     gatcagtacg cgcaattgaa agcgcaatat gctgataaac ctaaaaaacg tgtttttctg       480
     caattcggca ttaatccgcc atttacccag tggaaaagag tcgattcaga accaggtact       540
     cgaagttttg tggcggagaa aacatcttta aagacagccg ggttccctgg ccgcaagtta       600
     gccgcgaaca ggtgttag                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page