(data stored in ACNUC7421 zone)

EMBL: CP000247.PE193

CP000247.PE193       Location/Qualifiers
FT   CDS_pept        212829..213788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0193"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68233"
FT                   /db_xref="GOA:Q0TLE8"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TLE8"
FT                   /protein_id="ABG68233.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLRE
FT                   KSVELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGG
FT                   IARLDGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQY
FT                   STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEA
FT                   MAASLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA"
     atgagtctga atttccttga ttttgaacag ccgattgcag agctggaagc gaaaatcgat        60
     tctctgaccg cggttagccg tcaggatgag aaactggata ttaacatcga tgaagaagtg       120
     catcgtctgc gtgaaaaaag cgtagaactg acgcgtaaaa tcttcgccga tctcggtgca       180
     tggcagattg cgcaactggc acgccatcca cagcgtcctt ataccctgga ttacgttcgc       240
     ctggcatttg atgaatttga cgaactggct ggcgaccgcg cgtatgcaga cgataaagct       300
     atcgtcggtg gtatcgcccg tctcgatggt cgtccggtga tgatcattgg tcatcaaaaa       360
     ggtcgtgaaa ccaaagaaaa aattcgccgt aactttggta tgccagcgcc agaaggttac       420
     cgcaaagcac tgcgtctgat gcaaatggct gaacgtttta agatgcctat catcaccttt       480
     atcgacaccc cgggggctta tccgggcgtg ggcgcagaag aacgtggtca gtctgaagcc       540
     attgcacgca acctgcgtga aatgtctcgc ctcggcgtac cggtagtttg tacggttatc       600
     ggtgaaggtg gttctggtgg tgcgctggcg attggcgtgg gcgataaagt gaatatgctg       660
     caatacagca cctattccgt tatctcgccg gaaggttgtg catccattct gtggaagagc       720
     gctgacaaag cgccgctggc ggctgaagcg atgggtatca tcgctccgcg tctgaaagag       780
     ctgaaactga tcgactccat catcccggaa ccgctgggcg gtgctcaccg taacccggaa       840
     gcgatggcgg cgtctctgaa agcgcagctg ctggcggatc tggccgatct cgacgtgtta       900
     agcactgaag atttaaaaaa tcgtcgttat cagcgcctga tgagctacgg ctacgcgtaa       960
//

If you have problems or comments...

PBIL Back to PBIL home page