(data stored in ACNUC7421 zone)

EMBL: CP000247.PE196

CP000247.PE196       Location/Qualifiers
FT   CDS_pept        216538..217851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0196"
FT                   /product="putative cell cycle protein MesJ"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68236"
FT                   /db_xref="GOA:A0A454A146"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A146"
FT                   /protein_id="ABG68236.1"
FT                   /translation="MTLTLNRQLLSSRQILVAFSGGLDSTVLLHQLVQWRTENPGVTLR
FT                   AIHVHHGLSANADAWVKHCENICQQWQVPLVVERVQLAQEGLGIEAQARQARYQAFART
FT                   LLPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMAEVSEFAGTQLIRPLLARTRGEL
FT                   VQWALAHGLRWIEDESNQDDSYDRNFLRLRVVPLLQQRWPHFAEATARSAALCAEQESL
FT                   LDELLADDLAHCQTPQGTLQIAPMLAMSDARRAAIIRRWLAGQNAPMPSRDALVRIWQE
FT                   VALAREDASPCLRLGAFEIRRYQSQLWWIKSVAGQSETIVPWQTWLQPLELPAGLGSVQ
FT                   LTAGGDIRPPRADEAVSVRFKAPGLLHIVGRNGGRKLKKIWQELGVPPWLRDTTPLLFY
FT                   GETLIAAAGVFVTQEGVAVGENGVSFVWQKTLSQVKAG"
     atgacactca cgctcaatag acaacttctc tcctcacgcc agattctggt ggcctttagc        60
     ggcggccttg attctactgt cttactgcat caactggtgc agtggcggac ggaaaatccg       120
     ggcgtcactc tgcgcgctat ccatgtgcat cacggtttaa gcgccaatgc tgatgcatgg       180
     gtgaaacatt gtgaaaacat ctgccaacag tggcaggtgc cgctggtggt cgaacgtgtg       240
     cagcttgcgc aagaggggct aggtattgag gcccaggcgc ggcaggcacg ttatcaggca       300
     tttgcccgca ccttgttgcc cggtgaagtg ctggttacag cgcaacatct cgacgatcaa       360
     tgtgaaacct ttctgctggc gctaaaacgc ggtagcggcc ctgccgggct ttcggctatg       420
     gcggaagttt cggagtttgc cggaacacag cttatccgcc cgttgcttgc ccgcacgcgg       480
     ggagaactgg tgcagtgggc gttggcgcat ggtttacgct ggattgaaga cgaaagtaat       540
     caggatgata gctacgatcg taactttctg cgcctgcgcg tagtgccgtt attgcagcag       600
     cgttggccgc attttgccga agcaacagcc cgcagcgccg cactttgtgc tgaacaagag       660
     agcctgttag atgaactgct ggcggatgat ttagcgcact gtcaaactcc gcaggggacg       720
     ctgcagattg cgccaatgct ggcgatgagt gatgcccgtc gcgcggcgat tatccgccgc       780
     tggctagcag ggcagaatgc accgatgcct tcccgcgacg cgttggtgag gatctggcag       840
     gaagtggcgc tggcgcggga agatgcctcc ccctgtttac gtttgggcgc gtttgaaatc       900
     cgccgctatc agtcgcaact atggtggatt aaatccgttg ccgggcaaag cgaaaccatt       960
     gtgccgtggc agacgtggct acaaccgctg gaattaccgg cggggctggg aagtgtacag      1020
     cttactgcgg gaggcgatat tcgccctccg cgtgcagatg aagcggtcag cgtgcgtttc      1080
     aaagcgccag gactgctgca tattgtcggg cgcaacggcg gacgtaagct gaagaaaatc      1140
     tggcaagagt taggcgttcc gccgtggcta cgtgatacca cgccactgct gttttatggc      1200
     gaaacgctga ttgcggcggc aggggtattt gtgacgcaag aaggtgtggc tgtaggtgag      1260
     aatggcgtca gttttgtctg gcagaaaacg cttagtcaag tgaaagccgg ataa            1314
//

If you have problems or comments...

PBIL Back to PBIL home page