(data stored in ACNUC7421 zone)

EMBL: CP000247.PE205

CP000247.PE205       Location/Qualifiers
FT   CDS_pept        complement(223047..223754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0205"
FT                   /product="hypothetical protein YaeB"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68245"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A162"
FT                   /protein_id="ABG68245.1"
FT                   /translation="MSSFQFEQIGVIRSPYKEKFAVPRQPGLVKSANGELHLIAPYNQA
FT                   DAVRGLEAFSHLWILFVFHQTMEGGWRPTVRPPRLGGNARMGVFATRSTFRPNPIGMSL
FT                   VELKEVVCHKDSVILKLGSLDLVDGTPVVDIKPYLPFAESLPDASASYAQSAPAAEMAV
FT                   CFTAEVEKQLLTLKKRYPQLTLFIREVLAQDPRPAYRKGEETGKTYAVWLHDFNVRWRV
FT                   TDAGFEVFALEPR"
     atgagcagtt tccagttcga gcaaataggc gttattcgct cgccctataa agaaaaattc        60
     gccgttccgc gccagccagg tctggtaaaa agcgccaacg gcgaactaca tctcattgct       120
     ccctacaacc aggccgacgc cgttcgcggc ctggaagcat tcagccattt atggatcctt       180
     ttcgtctttc atcaaacgat ggaaggcggc tggcgtccga ctgtgcgtcc gcctcgtctc       240
     ggcggtaatg ccagaatggg tgttttcgct acgcgctcca cttttcgccc taacccgatt       300
     ggtatgtcgc tggtagagct gaaagaggtt gtttgccata aagatagcgt gattctgaag       360
     ctcggcagtc tggatctggt cgatggtacg ccggtagtgg atatcaaacc gtatctcccc       420
     tttgctgaat cgcttcccga tgccagtgcc agctatgcgc aaagtgcgcc agcggcagaa       480
     atggcggtgt gttttaccgc agaggtcgaa aagcagcttt tgacgctgaa gaagcgttat       540
     ccgcagttaa cgctgtttat ccgcgaagta ctggcgcagg acccgcgccc ggcctatcgt       600
     aaaggtgagg aaacgggcaa aacctatgcc gtctggctgc atgattttaa cgttcgctgg       660
     cgcgtcaccg acgcaggttt tgaagtcttt gcgctggaac cgcgttaa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page