(data stored in ACNUC7421 zone)

EMBL: CP000247.PE22

CP000247.PE22        Location/Qualifiers
FT   CDS_pept        complement(22358..22621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0022"
FT                   /product="30S ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68064"
FT                   /db_xref="GOA:Q0TLW7"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TLW7"
FT                   /protein_id="ABG68064.1"
FT                   /translation="MANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKA
FT                   AAQKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA"
     ttggctaata tcaaatcagc taagaagcgc gccattcagt ctgaaaaggc tcgtaagcac        60
     aacgcaagcc gtcgctctat gatgcgtact ttcatcaaga aagtatacgc agctatcgaa       120
     gctggcgaca aagctgctgc acagaaagca tttaacgaaa tgcaaccaat cgtggaccgt       180
     caggctgcta aaggtctgat ccacaaaaac aaagctgcac gtcataaggc taacctgact       240
     gcacagatca acaaactggc ttaa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page