(data stored in ACNUC7421 zone)

EMBL: CP000247.PE221

CP000247.PE221       Location/Qualifiers
FT   CDS_pept        complement(242751..243251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68261"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A188"
FT                   /protein_id="ABG68261.1"
FT                   /translation="MRLRRITMANPVYLTLNGELQGLISSGCSSMPSIGNKAQIAHQDQ
FT                   IMVTSLSHGLSRAQNVNHQELTITKPVDKSSPLLGKAISENECLTCDFVFYRTNRFGIN
FT                   EPYYKLKLANARLSNIGLTIPHTINDSPGQAEESVSFTYESINWEHSVAGTSAYSLWSE
FT                   RIF"
     ttgagattaa ggagaataac aatggcaaat cccgtctatc tgacactgaa cggagaactt        60
     caggggctga tttcatccgg atgctcgtca atgccgtcca tcggtaacaa agcccagatt       120
     gcacatcagg atcagatcat ggtgacgtca ctgtcccatg gtctgagccg tgcgcagaat       180
     gtcaaccatc aggagttgac catcacgaaa ccggtggaca aatcctcccc tctgctgggc       240
     aaggccattt cagagaatga atgtctgacc tgtgattttg tattctaccg caccaaccgc       300
     tttggaatta atgaaccgta ctacaagctg aaactggcta acgcccggct ctcaaacatc       360
     ggccttacca ttccccatac cattaacgac agtcctgggc aggcggaaga gtctgtgtca       420
     tttacctatg agagcatcaa ttgggagcac agcgtcgccg gaaccagtgc atacagcctt       480
     tggagtgaac ggattttcta a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page