(data stored in ACNUC7421 zone)

EMBL: CP000247.PE222

CP000247.PE222       Location/Qualifiers
FT   CDS_pept        complement(243248..244606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0225"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68262"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR021069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A191"
FT                   /protein_id="ABG68262.1"
FT                   /translation="MSNNALTQTIVTGSDPRALPEFSAIREEINKANHPSQPELNWKLV
FT                   ESLALSIFKANGVDLHTATYYTLARTRNQGLAGFCEGAELLAAMIIHEWDKFWPQSGPA
FT                   RTEMLDWFNTRTGNILRQQVSFSENDLSLLYRTERALQLICDKLQQVELKRQPRVENLL
FT                   YFVQNTRKRFEPQPRNRTDTAAQTMVRTLVYAPEGTASATAETMPPLPDLPEMRVGVRG
FT                   VADNADKAKQGDTVKGFVAGAACTAVIASALWWWQAYPMQQQLTQVRDTTQGAATVWLA
FT                   SPVLKEYEQYLQQLLNAPPLQPLETGMQMMRTADTLWPESLQQQEASRMWSNTLRNRAQ
FT                   ASPQMKGWQQARQNLRDFADLMMKKETEKQGFTLSYIKTVTWQAERLLNQETPLEYLLT
FT                   QYQETRTQKQDTQALEKEINERLDGLLSRWLLLKNTGQDMATDNRTEPVHPTH"
     atgagcaata acgcactgac acaaactatc gttaccggca gcgatccgcg cgccctgccg        60
     gagttcagcg ccatccgcga agaaattaac aaagctaacc acccgtcaca gccggagctg       120
     aactggaaac tggtggaatc gctggcgctg tcgattttta aggccaacgg ggtggatttg       180
     cataccgcca cctactatac gctggcacgt acacgtaatc agggactggc agggttctgt       240
     gaaggcgcgg aactgctggc tgcgatgatc atccacgaat gggataaatt ctggccgcag       300
     agtggcccgg cgcggactga gatgctggac tggttcaaca cccgcaccgg gaatatcctg       360
     cgccagcagg tttccttttc cgaaaatgat ctttcgttgc tctaccgcac ggaacgggct       420
     ttgcagctta tctgcgacaa actccagcaa gtggaactga agcgccagcc gcgcgtggaa       480
     aatctgcttt attttgtgca gaacacacgc aagcggtttg agccgcagcc cagaaaccgt       540
     actgatacgg cggcacagac catggtcaga acgctggtct atgcgcctga aggcacggct       600
     tccgccacag cggaaaccat gcccccccta cccgacctgc cggaaatgcg ggtgggggtg       660
     cgcggtgtgg cagataacgc cgacaaagca aaacagggcg acacggtaaa aggttttgtt       720
     gccggtgccg cctgtactgc cgttatcgca tctgcactct ggtggtggca ggcgtatccg       780
     atgcagcagc agcttacaca ggtcagggat accacacagg gagccgccac cgtctggttg       840
     gcctccccgg tactgaaaga atatgaacag tacctgcaac agcttctgaa tgccccgcca       900
     ctacagccgc tggaaaccgg aatgcagatg atgcgcaccg cagacaccct ctggccggaa       960
     agcctgcaac agcaggaagc cagcaggatg tggagcaaca cgctgagaaa ccgggcgcaa      1020
     gccagtccgc agatgaaggg ctggcaacaa gcgcggcaga atttgcggga ttttgcagat      1080
     ttgatgatga agaaggagac ggagaaacaa ggtttcaccc tatcgtatat caaaacggtg      1140
     acctggcagg ccgaacggtt actgaatcaa gaaacaccac tggagtacct gctgacgcag      1200
     taccaggaga cccgtacaca gaagcaggac acacaggcgt tggaaaaaga gatcaacgaa      1260
     cggctggacg ggctgttaag ccgctggctg ctgctgaaaa ataccggaca ggatatggca      1320
     acggataaca gaaccgaacc tgtccatcca actcattga                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page