(data stored in ACNUC7421 zone)

EMBL: CP000247.PE223

CP000247.PE223       Location/Qualifiers
FT   CDS_pept        complement(244617..248144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0226"
FT                   /product="IcmF-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68263"
FT                   /db_xref="GOA:A0A454A196"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A196"
FT                   /protein_id="ABG68263.1"
FT                   /translation="MFKFPTSRLFSTLKSALRPAMPRFKVSATWLLTLAWIFLLVWIWW
FT                   QGPKWTLYEQHWLAPLANRWLATAVWGLIALVWLTWRVMKRLQKLEKQQKQQREEEKDP
FT                   LTVELHRQQQYLDHWLLRLRRHLDNRRYLWQLPWYMVIGPAGSGKSTLLREGFPSDIVY
FT                   TPESIRGVEYHPLITPRVGNQAVIFDVDGVLTTPGGDDLLRRRLREHWLGWLMQTRARQ
FT                   PLNGLILTLDLPDLLTADKSRRETLVQNLRQQLQEIRQSLHCRLPVYVVLTRLDLLNGF
FT                   AALFHSLDKKDRDAILGVTFTRRAHESDGWRSELGAFWQTWVQQVNLALSDLVLAQTGA
FT                   APRSAVFSFSRQMQGTGEIVTALLAALLDGENMDVMLRGVWLTSSLQRGQVDDIFTQSA
FT                   ARQYGLGNSSLATWPLVETTPYFTRRLFPEVLLAEPNLAGENSVWLNSSRRRLTAFSTC
FT                   GAALAALMVGSWHHYYNQNWQSGVNVLAQAKAFMDVPLPQGTDEFGNLQLPLLNPVRDA
FT                   TLAYGDYRDHGFLADMGLYQGARVGPYVEQTYIQLLEQRYLPSLMNGLIRDLNIAPPES
FT                   EEKLAVLRVVRMMEDKSGRNNEAVKQYMARRWSNEFHGQRDIQAQLMVHLDYALEHTDW
FT                   HAQRQSSDSDAVSRWTPYNKPVINAQHELSKLPIYQRVYQTLRTKALSVLPADLNLRDQ
FT                   VGPTFDNVFVAGNDEKLVIPQFLTRYGLQSYFIKQHDGLVELTALDSWVLNLTQSVAYS
FT                   EADREEIQRHITEQYLSDYTATWRAGMDNLNVRDYETMPALTDALEQIISGDQPFLRAL
FT                   TALRDNTHALTLSGKLDDKAKEAAINEMDYRLLSRLGHEFAPENSALEEQKDKASTLQA
FT                   VYQQLTELHRYLLAIQNSPVSGKSALKAVQLRLDQNSSDPIFATRQMAKTLPAPLNRWV
FT                   GKLADQAWHVVMVEAVRYMEVDWRDNVVKPFNEQLADNYPFNPHATQDASLDSFERFFK
FT                   PDGILDNFYKNNLRLFLENDLTFGDDGRMLIREDIRQQLDTAQKIRNIFFSQQNGLGAQ
FT                   FAVETVSLSGNKRRSVLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESQLTLIGTSGRA
FT                   PRSIAFSGPWAQFRLFGAGQLTNVTSDTFNVRFNVDGGAMVYRVHVDTEDNPFTGGLFS
FT                   QFRLPDTLY"
     gtgttcaaat ttcccacatc ccgactgttc agcacgttga aatctgcgct caggccagcg        60
     atgccgcggt ttaaagtttc tgccacctgg ctactgacgc tggcatggat ttttctgctg       120
     gtgtggatct ggtggcaggg tccaaaatgg acgctctatg agcagcactg gttggctccg       180
     ctggcaaacc gctggctggc gaccgccgtc tggggactta tcgctctggt ctggctcacc       240
     tggcgggtga tgaagcgtct gcaaaagctg gaaaaacagc agaaacagca gcgggaggaa       300
     gaaaaagatc cgttgaccgt ggaactccac cgccagcagc aatatctgga tcactggctg       360
     ctgcgcctgc gccgccatct ggataaccgc cgttatctgt ggcagttgcc gtggtatatg       420
     gtcattggtc ctgcgggtag cggcaaaagc acgctgctgc gcgagggctt tccgtctgac       480
     attgtttaca cgccggaaag catccggggt gtggaatacc acccgctgat cacaccgcga       540
     gtgggcaacc aggcggtaat tttcgatgtt gacggcgtac tgaccactcc cggcggggat       600
     gatctgctcc gccgccgcct gcgcgaacac tggctgggct ggctgatgca aacgcgcgct       660
     cgccagccgc tcaacggtct tatcctgacg ctcgatcttc ccgatctgct gacggcggat       720
     aaatcccgcc gtgagacact ggtacaaaat ttgcgccagc aacttcagga gatccgtcag       780
     agcctgcact gccgtctgcc cgtttacgtg gtgctgacac ggctggatct gctgaacggc       840
     tttgccgcgc tgttccattc actggataaa aaagaccgcg atgcgatcct cggcgtcaca       900
     tttacccgcc gcgcccatga aagtgacggc tggcgcagcg aactgggggc tttctggcag       960
     acgtgggtac aacaggtgaa cctggcgctg tcggatctgg tgctcgcaca aaccggtgct      1020
     gctccccgca gcgctgtgtt cagcttctcc cgtcagatgc agggaacagg agaaatcgtc      1080
     accgcactgc tcgccgcatt gctggacggt gagaacatgg atgtaatgct gcgtggcgtc      1140
     tggctcacat cctcgctaca gcgtggccag gtggatgata ttttcacgca gtccgccgcc      1200
     cgccagtacg gactgggtaa cagctcgctg gcaacctggc ctctggtgga gacgacgccg      1260
     tattttactc gccgcctctt cccggaagtc ctgctggctg agccgaacct ggcgggtgaa      1320
     aacagcgtct ggctgaacag ctcccggcgc aggctgaccg ccttttccac ctgtggcgcg      1380
     gcactggcgg cattgatggt cggaagctgg caccattatt acaatcagaa ctggcagtct      1440
     ggcgttaacg tactggcaca agctaaagcc tttatggacg taccactacc gcagggaacg      1500
     gatgaattcg gcaatctgca attgccattg cttaacccgg tacgcgatgc caccctggcc      1560
     tatggtgatt atcgcgatca cggttttctg gcggatatgg gattgtacca gggcgcccgc      1620
     gtagggccgt atgtggagca aacctacatt cagcttcttg agcagcgtta tctcccctcg      1680
     ttaatgaacg gcctgatccg ggatctaaac attgccccgc cagagagcga agaaaagctc      1740
     gctgtgctgc gcgtagtgcg catgatggaa gacaaaagtg ggcgcaacaa cgaggcggta      1800
     aaacagtaca tggcgcggcg ctggagcaat gaatttcacg gccagcgcga tattcaggcg      1860
     caactgatgg tgcatctgga ctatgcgctg gagcacaccg actggcacgc gcagcgccaa      1920
     agcagcgaca gcgatgctgt aagccgctgg accccctata ataaaccggt cattaatgcg      1980
     caacatgaac tgagcaagct acccatatac cagcgtgtct accagaccct tcgcaccaaa      2040
     gcattaagcg tgttacccgc cgatttgaat ttgcgcgacc aggttggtcc caccttcgac      2100
     aacgtgttcg tcgccggtaa tgatgaaaaa ctggtgatcc cgcagtttct cacccgctat      2160
     ggcctgcaaa gctattttat caaacaacac gacggtctcg ttgagttgac cgcgctggat      2220
     tcgtgggtgc tgaacctgac gcaaagcgtc gcctacagcg aggccgaccg tgaagagatc      2280
     cagcgccata tcactgaaca gtacctcagt gactataccg ctacatggcg tgccggaatg      2340
     gataatctca acgtccgtga ctatgagacc atgccggcgc tgaccgacgc gctggagcag      2400
     attatcagcg gtgatcagcc attcctgcgt gctctgacgg cgctgcgcga taatacacac      2460
     gcgctgacgc tctccggcaa actggacgat aaggcgaagg aagcggcgat aaatgagatg      2520
     gattaccgcc tgttatcccg gctggggcat gagttcgcgc cggaaaatag cgcactggag      2580
     gagcaaaagg acaaggcgag tactctacag gccgtgtatc agcaactgac cgagctgcac      2640
     cgttacctgc tggcgatcca gaactcgcca gtgtctggga aatcggcgct gaaagcagta      2700
     cagctacggc tggatcaaaa cagcagcgat ccaatcttcg ccacccgtca gatggcaaaa      2760
     accctgcctg cgcctcttaa ccgctgggta ggtaagctgg cggatcaggc ctggcatgta      2820
     gtgatggtgg aagccgttcg ttacatggaa gtggactggc gcgacaatgt agtgaaaccc      2880
     ttcaacgagc agcttgccga taactatccg tttaatccgc acgccacaca ggatgcctca      2940
     ctggattcgt ttgaacgttt ctttaaaccg gatggcattc tggacaattt ctacaagaac      3000
     aacctgcgcc tgttccttga aaacgatctg acctttggcg acgacggcag aatgttaatc      3060
     cgtgaagata tccggcagca actggatact gcgcagaaaa tccgcaacat cttcttcagc      3120
     cagcagaacg ggctgggcgc acagtttgcc gtggaaaccg tatcgctttc cggcaataag      3180
     cggcgcagcg tacttaacct ggacggccag ttagtggact acagccaggg acgcaactac      3240
     accgcccatc tggtctggcc gaacaacatg cgtgaaggca atgaaagcca gctgacgctg      3300
     attggcacca gcggcagagc accgcgcagt atcgcgttca gcggaccgtg ggcgcagttc      3360
     cgcctgttcg gcgcgggcca gttgaccaat gtgaccagtg acacctttaa cgtgcgcttt      3420
     aacgtggacg gcggcgcgat ggtttaccgg gtgcatgtgg ataccgaaga taacccgttc      3480
     accggcggtc tgttcagcca gttccgttta ccggatacgt tgtattaa                   3528
//

If you have problems or comments...

PBIL Back to PBIL home page